DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3281 and ZBTB6

DIOPT Version :9

Sequence 1:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_006617.1 Gene:ZBTB6 / 10773 HGNCID:16764 Length:424 Species:Homo sapiens


Alignment Length:435 Identity:92/435 - (21%)
Similarity:160/435 - (36%) Gaps:121/435 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TPEIHVNI----SSQTCRVCLETHETNLYVHDEIKYNDLKLELWQLLEAVSKLKWTWTDPNLPMH 63
            |...||.|    |::..|..|.:..|...   |:|    :.||.:.|.|.|.|:.        :|
Human    65 TQSKHVRITILQSAEVGRKLLLSCYTGAL---EVK----RKELLKYLTAASYLQM--------VH 114

  Fly    64 LCQNCARRLIGAYEFIVEVENAHETLQNLFEQQEVAAKPDEVHVDVVELIDQDDVVSMAQYLSTS 128
            :.:.|...|....|..:.::|.::                  |.|:.:..|.|            
Human   115 IVEKCTEALSKYLEIDLSMKNNNQ------------------HTDLCQSSDPD------------ 149

  Fly   129 FAEQHVEMEEKYGDQDCSAFTSDVGEE-PLYASEDRDDEPEDSFQLKPRPDEIENRELSRPS--- 189
                 |:.|::..|:||...  ::.|: |:.......:|..::.|........|.:|:..|.   
Human   150 -----VKNEDENSDKDCEII--EISEDSPVNIDFHVKEEESNALQSTVESLTSERKEMKSPELST 207

  Fly   190 -QLGSRLN---------------HSANFIYKCAVCPRVFAKSESLTRHFSQA-HKLTADVAAMKL 237
             .:|.:.|               .:..|...|.        |...:.:||:. |.|.......::
Human   208 VDIGFKDNEICILHVESISTAGVENGQFSQPCT--------SSKASMYFSETQHSLINSTVESRV 264

  Fly   238 A----NESCGTGLLTCEHCPRTFKRQDTLRRHMQAFHPDAIALEPEETTDNSARKRIAKRRDCPH 298
            |    |:..|   |.||:...::.....::...:.:                     :.|..||.
Human   265 AEVPGNQDQG---LFCENTEGSYGTVSEIQNLEEGY---------------------SLRHQCPR 305

  Fly   299 CGLSF-PVSSLTIHIRRHTGDNPYKCDQCEKAFPRSQDLSLHMRQHTGERPSECKICSKKFISQN 362
            |...| .|.:...|::.|   ..:.|.||.|.|.:.::|:.|:|.|.|.||.:|.:|.|.|.:::
Human   306 CPRGFLHVENYLRHLKMH---KLFLCLQCGKTFTQKKNLNRHIRGHMGIRPFQCTVCLKTFTAKS 367

  Fly   363 KLARHMRLHTGQRPYSCKMCSKSFVQSNDLKIHMR----RHTGER 403
            .|..|:.:|:|.|||.|..|...|...:.||.|:.    |.:||:
Human   368 TLQDHLNIHSGDRPYKCHCCDMDFKHKSALKKHLTSVHGRSSGEK 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3281NP_650132.1 zf-AD 14..92 CDD:285071 16/77 (21%)
C2H2 Zn finger 205..226 CDD:275368 4/21 (19%)
C2H2 Zn finger 249..266 CDD:275368 2/16 (13%)
COG5048 <294..>391 CDD:227381 33/97 (34%)
C2H2 Zn finger 296..315 CDD:275368 6/19 (32%)
zf-H2C2_2 307..330 CDD:290200 6/22 (27%)
C2H2 Zn finger 323..343 CDD:275368 8/19 (42%)
zf-H2C2_2 335..358 CDD:290200 10/22 (45%)
C2H2 Zn finger 351..371 CDD:275368 6/19 (32%)
zf-H2C2_2 364..388 CDD:290200 10/23 (43%)
C2H2 Zn finger 379..399 CDD:275368 6/23 (26%)
zf-H2C2_2 391..416 CDD:290200 6/17 (35%)
C2H2 Zn finger 407..424 CDD:275368
ZBTB6NP_006617.1 BTB_POZ_ZBTB6 8..123 CDD:349506 18/72 (25%)
C2H2 Zn finger 303..323 CDD:275368 6/19 (32%)
zf-C2H2 326..348 CDD:395048 8/21 (38%)
C2H2 Zn finger 328..348 CDD:275368 8/19 (42%)
zf-C2H2_8 331..401 CDD:406359 26/69 (38%)
zf-H2C2_2 340..364 CDD:404364 10/23 (43%)
C2H2 Zn finger 356..376 CDD:275368 6/19 (32%)
C2H2 Zn finger 384..401 CDD:275368 5/16 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 402..424 3/11 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.