DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3281 and ZBTB18

DIOPT Version :9

Sequence 1:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_991331.1 Gene:ZBTB18 / 10472 HGNCID:13030 Length:531 Species:Homo sapiens


Alignment Length:338 Identity:77/338 - (22%)
Similarity:121/338 - (35%) Gaps:94/338 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 QQEVAAKPDEVHVD-VVELIDQDDVVSMAQYLSTSFAEQHV---EMEEKYGDQDCSAFTSDVG-- 153
            |:.|.:..|...|| |::|..:..:..:....|:.|:.|.|   .:.:...:::.|...||||  
Human   233 QRSVTSVRDSADVDCVLDLSVKSSLSGVENLNSSYFSSQDVLRSNLVQVKVEKEASCDESDVGTN 297

  Fly   154 ------------------------------EEPLYASEDRDDEPEDSFQLKPRPDEIENRELSRP 188
                                          |:.:....||:|:..|...:.|..:.::.......
Human   298 DYDMEHSTVKESVSTNNRVQYEPAHLAPLREDSVLRELDREDKASDDEMMTPESERVQVEGGMES 362

  Fly   189 SQLG--SRLNHSANFIYKCAVCPRVFAKSESLTRHFSQAHKLTADVAAMKLANESCGTGLLTCEH 251
            |.|.  |.:...|..|:.|.:|.:||.....|..|.| .|....|....|.|.:   ..:.||..
Human   363 SLLPYVSNILSPAGQIFMCPLCNKVFPSPHILQIHLS-THFREQDGIRSKPAAD---VNVPTCSL 423

  Fly   252 CPRTFKRQDTLRRHMQAFHPDAIALEPEETTDNSARKRIAKRRDCPHCGLSFPVSSLTIHIRRHT 316
            |.:||....||:||.                                              |.|:
Human   424 CGKTFSCMYTLKRHE----------------------------------------------RTHS 442

  Fly   317 GDNPYKCDQCEKAFPRSQDLSLHMRQHTGERPSECKICSKKFISQNKLARHMRLHTGQRPYSCKM 381
            |:.||.|.||.|:|..|.:||.|...||.|:|..||.|.::|.....|.||:      |.:.|::
Human   443 GEKPYTCTQCGKSFQYSHNLSRHAVVHTREKPHACKWCERRFTQSGDLYRHI------RKFHCEL 501

  Fly   382 CSKSFVQSNDLKI 394
            .:...|:|..|.:
Human   502 VNSLSVKSEALSL 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3281NP_650132.1 zf-AD 14..92 CDD:285071
C2H2 Zn finger 205..226 CDD:275368 7/20 (35%)
C2H2 Zn finger 249..266 CDD:275368 7/16 (44%)
COG5048 <294..>391 CDD:227381 29/96 (30%)
C2H2 Zn finger 296..315 CDD:275368 1/18 (6%)
zf-H2C2_2 307..330 CDD:290200 9/22 (41%)
C2H2 Zn finger 323..343 CDD:275368 9/19 (47%)
zf-H2C2_2 335..358 CDD:290200 10/22 (45%)
C2H2 Zn finger 351..371 CDD:275368 7/19 (37%)
zf-H2C2_2 364..388 CDD:290200 5/23 (22%)
C2H2 Zn finger 379..399 CDD:275368 4/16 (25%)
zf-H2C2_2 391..416 CDD:290200 1/4 (25%)
C2H2 Zn finger 407..424 CDD:275368
ZBTB18NP_991331.1 BTB 23..119 CDD:279045
BTB 34..119 CDD:197585
COG5048 <303..>490 CDD:227381 53/236 (22%)
C2H2 Zn finger 381..401 CDD:275368 7/20 (35%)
C2H2 Zn finger 421..441 CDD:275368 9/65 (14%)
zf-H2C2_2 434..456 CDD:290200 12/67 (18%)
C2H2 Zn finger 449..469 CDD:275368 9/19 (47%)
C2H2 Zn finger 477..495 CDD:275368 7/23 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.