| Sequence 1: | NP_650132.1 | Gene: | CG3281 / 41445 | FlyBaseID: | FBgn0260741 | Length: | 538 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001157929.1 | Gene: | ZNF705G / 100131980 | HGNCID: | 37134 | Length: | 300 | Species: | Homo sapiens |
| Alignment Length: | 209 | Identity: | 68/209 - (32%) |
|---|---|---|---|
| Similarity: | 93/209 - (44%) | Gaps: | 41/209 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 258 RQDTLRR-HMQAFHP----DA----------IALEPEETTD-----------------NSARKRI 290
Fly 291 AKRRDCPHCGLSF-PVSSLTIHIRRHTGDNPYKCDQCEKAFPRSQDLSLHMRQHTGERPSECKIC 354
Fly 355 SKKFISQNKLARHMRLHTGQRPYSCKMCSKSFVQSNDLKIHMRRHTGERPYQCGVCGESFVCGSH 419
Fly 420 LN----IHRNRKGH 429 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG3281 | NP_650132.1 | zf-AD | 14..92 | CDD:285071 | |
| C2H2 Zn finger | 205..226 | CDD:275368 | |||
| C2H2 Zn finger | 249..266 | CDD:275368 | 2/8 (25%) | ||
| COG5048 | <294..>391 | CDD:227381 | 40/97 (41%) | ||
| C2H2 Zn finger | 296..315 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 307..330 | CDD:290200 | 9/22 (41%) | ||
| C2H2 Zn finger | 323..343 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 335..358 | CDD:290200 | 11/22 (50%) | ||
| C2H2 Zn finger | 351..371 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 364..388 | CDD:290200 | 13/23 (57%) | ||
| C2H2 Zn finger | 379..399 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 391..416 | CDD:290200 | 9/24 (38%) | ||
| C2H2 Zn finger | 407..424 | CDD:275368 | 5/20 (25%) | ||
| ZNF705G | NP_001157929.1 | KRAB | 7..66 | CDD:214630 | |
| KRAB | 7..46 | CDD:279668 | |||
| COG5048 | <92..246 | CDD:227381 | 51/157 (32%) | ||
| C2H2 Zn finger | 118..138 | CDD:275368 | 1/19 (5%) | ||
| C2H2 Zn finger | 147..166 | CDD:275368 | 5/22 (23%) | ||
| C2H2 Zn finger | 174..194 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 186..211 | CDD:290200 | 12/24 (50%) | ||
| C2H2 Zn finger | 202..222 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 214..239 | CDD:290200 | 13/24 (54%) | ||
| C2H2 Zn finger | 230..250 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 258..278 | CDD:275368 | 4/19 (21%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165146597 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||