| Sequence 1: | NP_650132.1 | Gene: | CG3281 / 41445 | FlyBaseID: | FBgn0260741 | Length: | 538 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001076468.1 | Gene: | zbtb49 / 100009630 | ZFINID: | ZDB-GENE-070209-170 | Length: | 524 | Species: | Danio rerio |
| Alignment Length: | 216 | Identity: | 72/216 - (33%) |
|---|---|---|---|
| Similarity: | 95/216 - (43%) | Gaps: | 54/216 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 239 NESCGTGLLTCEHCPRTFKRQDTLRRHMQAFHPDAIALEPEETTDNSARKRIAKRRDCPHCGLSF 303
Fly 304 -PVSSLTIHIRRHTGDNPYKCDQCEKAFPRSQDLSLHMRQHTGERPSECKI-------------- 353
Fly 354 --------------CSKKFISQNKLARHMRLHTGQRPYSCKMCSKSFVQSNDLKIHMRRHTGERP 404
Fly 405 YQCGVCGESFVCGSHLNIHRN 425 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG3281 | NP_650132.1 | zf-AD | 14..92 | CDD:285071 | |
| C2H2 Zn finger | 205..226 | CDD:275368 | |||
| C2H2 Zn finger | 249..266 | CDD:275368 | 6/16 (38%) | ||
| COG5048 | <294..>391 | CDD:227381 | 40/125 (32%) | ||
| C2H2 Zn finger | 296..315 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 307..330 | CDD:290200 | 11/22 (50%) | ||
| C2H2 Zn finger | 323..343 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 335..358 | CDD:290200 | 9/50 (18%) | ||
| C2H2 Zn finger | 351..371 | CDD:275368 | 8/47 (17%) | ||
| zf-H2C2_2 | 364..388 | CDD:290200 | 10/23 (43%) | ||
| C2H2 Zn finger | 379..399 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 391..416 | CDD:290200 | 16/24 (67%) | ||
| C2H2 Zn finger | 407..424 | CDD:275368 | 6/16 (38%) | ||
| zbtb49 | NP_001076468.1 | zf-H2C2_2 | 322..346 | CDD:290200 | 11/23 (48%) |
| C2H2 Zn finger | 338..358 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 366..386 | CDD:275368 | 1/19 (5%) | ||
| zf-H2C2_2 | 378..402 | CDD:290200 | 2/23 (9%) | ||
| C2H2 Zn finger | 394..414 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 407..430 | CDD:290200 | 9/22 (41%) | ||
| C2H2 Zn finger | 422..442 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 434..459 | CDD:290200 | 16/24 (67%) | ||
| C2H2 Zn finger | 450..467 | CDD:275368 | 6/16 (38%) | ||
| BTB | 15..118 | CDD:279045 | |||
| BTB | 26..118 | CDD:197585 | |||
| zf-C2H2 | 280..302 | CDD:278523 | 10/39 (26%) | ||
| C2H2 Zn finger | 282..302 | CDD:275368 | 9/31 (29%) | ||
| COG5048 | <292..466 | CDD:227381 | 61/180 (34%) | ||
| zf-H2C2_2 | 294..319 | CDD:290200 | 7/31 (23%) | ||
| C2H2 Zn finger | 310..330 | CDD:275368 | 7/19 (37%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||