DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad87A and Pcdhb17

DIOPT Version :9

Sequence 1:NP_731649.2 Gene:Cad87A / 41441 FlyBaseID:FBgn0037963 Length:1975 Species:Drosophila melanogaster
Sequence 2:NP_444372.2 Gene:Pcdhb17 / 93888 MGIID:2136754 Length:799 Species:Mus musculus


Alignment Length:803 Identity:186/803 - (23%)
Similarity:304/803 - (37%) Gaps:247/803 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 DYFLLDAQTGELRTAKPLDREALEDSTGIIS-LVIRARELVNGVPSDDPLTSATAKATVTIRDVN 352
            ::..|:.|:|:|...:.||||.|   .|.|. .|:..:.|:     ::||  ...:|.:.:.|:|
Mouse    73 EHLQLNLQSGDLLINEKLDREEL---CGPIEPCVLHFQVLM-----ENPL--EVFQAELRVMDIN 127

  Fly   353 DSPPVFNHKEYSVSLLENTLPGTPLALDMSVSDADVGINSKFALRLDDVSGVFDVEPKLVTGYSQ 417
            |..|||:.:|..:.:|||:..|....|:.:: |:||.||:....||...|....|......|   
Mouse   128 DYSPVFSEREMILRILENSALGDTFPLNNAL-DSDVAINNIQTYRLSSNSHFLVVTRNRSDG--- 188

  Fly   418 VNIRVANGTLDYENPNQRKFIVLVVAEETDTN----------------PRLSSTATITVSVLDAN 466
                             ||:..||:.:|.|..                |..|.||.:.:.|:|.|
Mouse   189 -----------------RKYPELVLEKELDREEEPELRLTLTALDGGAPPRSGTAQVLIEVVDIN 236

  Fly   467 DNKPVFEQESYSASVSEAALPGQYIATITARDVDSGSYGDSGIRYSLSGTGAEL---FHVNEQTG 528
            ||.|.|:|.:|...:.|.:..|..:.|::|.|:|||.||.  :.|:||....::   ..||..||
Mouse   237 DNAPKFQQPTYRVQIPENSPTGSLVLTVSANDLDSGDYGK--VLYALSQPSEDISKTLEVNPVTG 299

  Fly   529 VISLANCHDNGESNRRERRDLNEDEHVEEDDGEGHLEMLSMEAATREIGTEPTVQYTLITQAPEE 593
            .|.|          |:|                                                
Mouse   300 EIRL----------RKE------------------------------------------------ 306

  Fly   594 QASSVPLPAPVPHAAPSGVPAATANDDKAPQTCLDYESETTYFLSYKATDDNGRGSASVVSLRIS 658
                                             :|:|:..:|.:..||||  |.|.:...:|.:.
Mouse   307 ---------------------------------VDFETIPSYEVDIKATD--GGGLSGKCTLLLK 336

  Fly   659 VTDANDSPP-----VCESPLYRASVDEGAVVF-------------------DSPLIVKARDADTM 699
            |.|.||:.|     ...||:...|.||...||                   |.|.::|:...:..
Mouse   337 VVDVNDNAPEVMLSALTSPVPENSPDEVVAVFSVKDPDSANNGKMIASIEEDLPFLLKSSGKNFY 401

  Fly   700 SRISYRIRGSEQVESIFDIDRETGQIIIRPNATLDVTNLNSDQLIFAVEANDGLFTAHCGVNITV 764
            :.::.|.           :|||..:   :.|.|:.|::|.:.:|.          |.|. :.:.|
Mouse   402 TLVTKRA-----------LDREERE---KYNITITVSDLGTPRLT----------TQHT-ITVQV 441

  Fly   765 RDVNNHVPNFEQQSYSAVVEENSEIGTSVERVHATDLDTGKNAELRYRI-----QQGSFDD-FGI 823
            .|.|::.|.|.|.||:..|.||:.....:..:.|||.|.|.|:.:.|.:     .|.:.|. ..|
Mouse   442 SDTNDNAPAFNQTSYTLFVRENNSPAMHIGTISATDSDAGSNSHISYSLLPSHDPQLALDSLISI 506

  Fly   824 VETTGEVFVSRKLDFDRRNTYQLQIQASDQGTPSLTGTATLTINVQNSNDKDPYFVPATQHAEV- 887
            ....|::|..|.||::....::..:.|.|||:|:|:..|.:.:.|.:.||..|:.:...|::.. 
Mouse   507 NADNGQLFALRALDYEALQAFEFHVGAIDQGSPALSSQALVRVVVLDDNDNAPFVLYPMQNSSAP 571

  Fly   888 ------RADAPPGQLVYTLIALDPDVANHNALEFAGTDDITAIDKEGKELPHYDQFKEYFKI-SR 945
                  || |.||.||..::|:|.|...:..|.|    .:....:.|           .|.: :.
Mouse   572 CTELLPRA-AEPGYLVTKVVAVDRDSGQNAWLSF----QLLKATEPG-----------LFSVWAH 620

  Fly   946 NGKVSVNKQLDRNLFAVMRINVLVTDSTAPNVQQGRGLLIIQIIDVNKNPPRFNAPWSVEQPQIK 1010
            ||:|...:.|........|:.:||.|:..| .:.....|.:.::|            ...||.:.
Mouse   621 NGEVRTTRLLSERDVPKHRLVLLVKDNGDP-PRSASVTLHVLVVD------------GFSQPYLP 672

  Fly  1011 LQMVEEQPVGTVLTTLQANDEDS 1033
            |..|...|         |:|||:
Mouse   673 LPEVARNP---------AHDEDA 686

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad87ANP_731649.2 Cadherin_repeat 33..128 CDD:206637
Cadherin_repeat 136..240 CDD:206637
Cadherin_repeat 248..353 CDD:206637 17/64 (27%)
Cadherin_repeat 362..468 CDD:206637 29/121 (24%)
Cadherin_repeat 476..>533 CDD:206637 19/59 (32%)
E_set <627..667 CDD:298831 14/39 (36%)
CA 692..772 CDD:214520 15/79 (19%)
Cadherin_repeat 778..873 CDD:206637 28/100 (28%)
Cadherin_repeat 882..994 CDD:206637 26/119 (22%)
Cadherin_repeat 1015..1099 CDD:206637 5/19 (26%)
Cadherin_repeat 1108..1207 CDD:206637
Cadherin_repeat 1215..1314 CDD:206637
Cadherin_repeat 1327..1427 CDD:206637
Cadherin_repeat 1437..1549 CDD:206637
Cadherin_repeat 1557..1662 CDD:206637
Pcdhb17NP_444372.2 Cadherin_2 33..112 CDD:285466 13/46 (28%)
Cadherin_repeat 137..238 CDD:206637 29/121 (24%)
Cadherin_repeat 246..343 CDD:206637 35/191 (18%)
Cadherin_repeat 356..447 CDD:206637 22/115 (19%)
Cadherin_repeat 455..557 CDD:206637 29/101 (29%)
Cadherin_repeat 576..664 CDD:206637 24/104 (23%)
Cadherin_C_2 687..770 CDD:293101 186/803 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.