DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad87A and CDHR1

DIOPT Version :9

Sequence 1:NP_731649.2 Gene:Cad87A / 41441 FlyBaseID:FBgn0037963 Length:1975 Species:Drosophila melanogaster
Sequence 2:XP_011538639.1 Gene:CDHR1 / 92211 HGNCID:14550 Length:917 Species:Homo sapiens


Alignment Length:944 Identity:247/944 - (26%)
Similarity:382/944 - (40%) Gaps:276/944 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LGLLMICLGL----TLAKGETNLPPVF-----TQTLNNIILY---ENVTVGTVVFRLEAYDPEGS 57
            ||:|  |||:    .|...:.|..|.|     ..|..|:.|:   |:..||:.|:.|...||||.
Human    61 LGVL--CLGVRLFCVLFPAQANFAPHFFDNGVGSTNGNMALFSLPEDTPVGSHVYTLNGTDPEGD 123

  Fly    58 PVTYGAIGADH-----FSVDPVSGNITLIKPLDREEKDTLKFLVSIRDRVDPEGESERDNVVEVP 117
            |::| .|..|.     |||||..|||||::.||||.:|.::.::||.|.:         |:|...
Human   124 PISY-HISFDPSTRSVFSVDPTFGNITLVEELDREREDEIEAIISISDGL---------NLVAEK 178

  Fly   118 ITFIILDLNDNPPEFQNTPYEADVNEDAAVGTTIFDKITVKDRDIVGESLDLKCLPQQQSPEACR 182
            :..::.|.||..|.|...||.|.|.||...|:.|| |:...|||..........|....||.|  
Human   179 VVILVTDANDEAPRFIQEPYVALVPEDIPAGSIIF-KVHAVDRDTGSGGSVTYFLQNLHSPFA-- 240

  Fly   183 KFRLHIIKRDATILEAAVVLNDTLNYNQRMVYHFQIEATDGPHK---------TQTTFEARVKDV 238
                  :.|.:.:|.  :....||:|.:...::..:.|.||..:         ..||....|:||
Human   241 ------VDRHSGVLR--LQAGATLDYERSRTHYITVVAKDGGGRLHGADVVFSATTTVTVNVEDV 297

  Fly   239 QDKPPVFQGS-LSTVIDEDSPINTLVLTVHARDGDTGEPRKIVYDLRTNPND-YFLLDAQTGELR 301
            ||..|||.|: ....:.||:...:.||.|.|.|||.|:|.:|:|.| .|.|| .|.::..:|.:.
Human   298 QDMAPVFVGTPYYGYVYEDTLPGSEVLKVVAMDGDRGKPNRILYSL-VNGNDGAFEINETSGAIS 361

  Fly   302 -TAKP--LDREALEDSTGIISLVIRARELVNGVPSDDPLTSATAKATVTIRDVNDSPPVF----- 358
             |..|  |.||..|       |.::..|:   .|:..|...||...|:.|.|:|:.||.|     
Human   362 ITQSPAQLQREVYE-------LHVQVTEM---SPAGSPAAQATVPVTIRIVDLNNHPPTFYGESG 416

  Fly   359 NHKEYSVSLLENTLPGTPL-ALDMSVSDADVGINSKFALRLDDVSGVFDVEPKLVTGYSQVNIRV 422
            ....:.:|:.|:...|..| .|.::|:|:|.|.|:||.|:|....|:|.|.|:.|...:||.|.|
Human   417 PQNRFELSMNEHPPQGEILRGLKITVNDSDQGANAKFNLQLVGPRGIFRVVPQTVLNEAQVTIIV 481

  Fly   423 AN-GTLDYENPNQRKFIVLVVAEETDTNPRLSSTATITVSVLDANDNKPVFEQESYSASVSEAAL 486
            .| ..:|:|......|.:|.|  |.:|..:.||||.:.:.:||.|||.|.|:...|.|.:.|.|.
Human   482 ENSAAIDFEKSKVLTFKLLAV--EVNTPEKFSSTADVVIQLLDTNDNVPKFDSLYYVARIPENAP 544

  Fly   487 PGQYIATITARDVDSGSYGDSGIRYSLSGTGAELFHVNEQTGVISLANCHDNGESNRRERRDLNE 551
            .|..:..:||.|.|:|.:|:  ::||..||||:||.::..||:|                     
Human   545 GGSSVVAVTAVDPDTGPWGE--VKYSTYGTGADLFLIHPSTGLI--------------------- 586

  Fly   552 DEHVEEDDGEGHLEMLSMEAATREIGTEPTVQYTLITQAPEEQASSVPLPAPVPHAAPSGVPAAT 616
                                            ||                               
Human   587 --------------------------------YT------------------------------- 588

  Fly   617 ANDDKAPQTCLDYESETTYFLSYKATDDNGRGSASVVSLRISVTDANDSPPVCESPLYRASVDEG 681
                 .|...||.|:...|....||.|..|:  .||..:.|::.|.||.|     |.:..||.:.
Human   589 -----QPWASLDAEATARYNFYVKAEDMEGK--YSVAEVFITLLDVNDHP-----PQFGKSVQKK 641

  Fly   682 AVVFDSPLIVKARDADT---MSRISYRIRGSEQVESIFDIDRETGQIIIRPNATLDVTNLNSDQL 743
            .:|..:|:.::|.|.|.   .:.:.|.|..:|.. ::|||:..||:|.::          ||   
Human   642 TMVLGTPVKIEAIDEDAEEPNNLVDYSITHAEPA-NVFDINSHTGEIWLK----------NS--- 692

  Fly   744 IFAVEANDGLFTAHCGVNITVRDVNNHVPNFEQQSYSAVVEENSEIGTSVERVHATDLDTGKNAE 808
                                :|                          |::.:|  ::..|::. 
Human   693 --------------------IR--------------------------SLDALH--NITPGRDC- 708

  Fly   809 LRYRIQQGSFDDFGIVETTGEVFVSRKLDFDRRNTYQLQIQASDQGTPSLTGTATLTINVQNSN- 872
                                              .:.|::||.|:|:||.:.||.|.|::.::. 
Human   709 ----------------------------------LWSLEVQAKDRGSPSFSTTALLKIDITDAET 739

  Fly   873 -DKDPY--FVPATQHAEVRADAPPGQLVYTLIAL 903
             .:.|.  |:..|:...::|.......:.|::|:
Human   740 LSRSPMAAFLIQTKDNPMKAVGVLAGTMATVVAI 773

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad87ANP_731649.2 Cadherin_repeat 33..128 CDD:206637 37/102 (36%)
Cadherin_repeat 136..240 CDD:206637 30/112 (27%)
Cadherin_repeat 248..353 CDD:206637 34/109 (31%)
Cadherin_repeat 362..468 CDD:206637 38/107 (36%)
Cadherin_repeat 476..>533 CDD:206637 22/56 (39%)
E_set <627..667 CDD:298831 14/39 (36%)
CA 692..772 CDD:214520 15/82 (18%)
Cadherin_repeat 778..873 CDD:206637 14/96 (15%)
Cadherin_repeat 882..994 CDD:206637 4/22 (18%)
Cadherin_repeat 1015..1099 CDD:206637
Cadherin_repeat 1108..1207 CDD:206637
Cadherin_repeat 1215..1314 CDD:206637
Cadherin_repeat 1327..1427 CDD:206637
Cadherin_repeat 1437..1549 CDD:206637
Cadherin_repeat 1557..1662 CDD:206637
CDHR1XP_011538639.1 Cadherin_repeat 100..188 CDD:206637 34/97 (35%)
Cadherin_repeat 197..299 CDD:206637 30/112 (27%)
Cadherin_repeat 308..407 CDD:206637 35/109 (32%)
Cadherin_repeat 421..526 CDD:206637 38/106 (36%)
Cadherin_repeat 535..630 CDD:206637 38/187 (20%)
Cadherin_repeat 646..737 CDD:206637 30/187 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24028
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.