DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad87A and PCDHA6

DIOPT Version :9

Sequence 1:NP_731649.2 Gene:Cad87A / 41441 FlyBaseID:FBgn0037963 Length:1975 Species:Drosophila melanogaster
Sequence 2:NP_061732.1 Gene:PCDHA6 / 56142 HGNCID:8672 Length:950 Species:Homo sapiens


Alignment Length:704 Identity:183/704 - (25%)
Similarity:306/704 - (43%) Gaps:134/704 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   652 VVSLRISVTDANDSPPVCESPLYRASVDEGAV-VFDSPL------IVKARDADTMSR--ISYRIR 707
            |..:.:.|.|.||:||:       ..|:|..| :::|.|      :..|.|||..|.  ::|::.
Human   116 VFHVDVEVRDINDNPPL-------FPVEEQRVLIYESRLPDSVFPLEGASDADVGSNSILTYKLS 173

  Fly   708 GSE----QVESIFDIDRETGQIIIRPNATLDVTNLNSDQLIFAVEANDG---LFTAHCGVNITVR 765
            .||    .|:...|.:::.|.::   ..:||.....:..|.  :.|.||   ..|....:.:||.
Human   174 SSEYFGLDVKINSDDNKQIGLLL---KKSLDREEAPAHNLF--LTATDGGKPELTGTVQLLVTVL 233

  Fly   766 DVNNHVPNFEQQSYSAVVEENSEIGTSVERVHATDLDTGKNAELRYRIQQGSF---------DDF 821
            |||::.|.|||..|...:.||::.||:|.|::|:|.|.|.|..:.|     ||         |.|
Human   234 DVNDNAPTFEQSEYEVRIFENADNGTTVIRLNASDRDEGANGAISY-----SFNSLVAAMVIDHF 293

  Fly   822 GIVETTGEVFVSRKLDFDRRNTYQLQIQASDQGTPSLTGTATLTINVQNSNDKDPYFVPATQHAE 886
            .|...|||:.:...|||::.|.|::.|.|:|:|.|.:.|..|:.:.:.:.||..|.....:....
Human   294 SIDRNTGEIVIRGNLDFEQENLYKILIDATDKGHPPMAGHCTVLVRILDKNDNVPEIALTSLSLP 358

  Fly   887 VRADAPPGQLVYTLIALDPDVANHNALEFAGTDDITAIDKEGKELPH-----YDQFKEYFKISRN 946
            ||.||..|.::..:...|.|...:..:..:.|             ||     ...||.|:.:   
Human   359 VREDAQFGTVIALISVNDLDSGANGQVNCSLT-------------PHVPFKLVSTFKNYYSL--- 407

  Fly   947 GKVSVNKQLDRNLFAVMRINVLVTDSTAPNVQQGRGLLIIQIIDVNKNPPRFNAPWSVEQPQIKL 1011
               .::..|||...:...:.|...|..:|:: .....|.:::.|:|.|.|.|      .||:..:
Human   408 ---VLDSALDRESVSAYELVVTARDGGSPSL-WATASLSVEVADMNDNAPAF------AQPEYTV 462

  Fly  1012 QMVEEQPVGTVLTTLQANDEDSS-------------IGEFNISDNDYFAINQTSGMIYTIARLDY 1063
            .:.|..|.|..:.|:.|.|.|:.             :||..:|  .|.:::..||.:|.:..||:
Human   463 FVKENNPPGCHIFTVSARDADAQENALVSYSLVERRVGERALS--SYISVHAESGKVYALQPLDH 525

  Fly  1064 EVVKEVKFQVTVSDTGVPALTATADVVVDIINLNDNDPKFSQSDYYFN---VTENSPR----GTV 1121
            |.::.::|||:..|.|||.|.:...:.|.:::.|||.|..........   |:|..||    |.|
Human   526 EELELLQFQVSARDAGVPPLGSNVTLQVFVLDENDNAPALLAPRVGGTGGAVSELVPRSLGAGQV 590

  Fly  1122 AGKVEAHDGDVGVFGEITYTL--IGENNKY-FSIDAYTGNVMVANSSILDREQIKELTLSVVAQD 1183
            ..||.|.|.|.|....::|.|  ...:.:: |.:..|||.  ::.:.:||........|.|:.:|
Human   591 VAKVRAVDADSGYNAWLSYELQPPASSARFPFRVGLYTGE--ISTTRVLDEADSPRHRLLVLVKD 653

  Fly  1184 KAPAAVQKSATATIHINILDVNDNAPVFTRDVYNSTVAENAAYQPPAALLQVQAIDQDEGLYGDV 1248
            ....|:  :||||:.::::: :..||      ..|:.|...|..|.|||:.|..           
Human   654 HGEPAL--TATATVLVSLVE-SGQAP------KASSRASVGAAGPEAALVDVNV----------- 698

  Fly  1249 RYIITAGNEMGLFKLDAQSGIVYPAQSLSGKHGAYELTISARDTQGSGTMESTT 1302
             |:|.|  ...:..|...:.::|.|           |..||..|:|:.|.:..|
Human   699 -YLIIA--ICAVSSLLVLTLLLYTA-----------LRCSAPPTEGACTADKPT 738

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad87ANP_731649.2 Cadherin_repeat 33..128 CDD:206637
Cadherin_repeat 136..240 CDD:206637
Cadherin_repeat 248..353 CDD:206637
Cadherin_repeat 362..468 CDD:206637
Cadherin_repeat 476..>533 CDD:206637
E_set <627..667 CDD:298831 5/14 (36%)
CA 692..772 CDD:214520 23/88 (26%)
Cadherin_repeat 778..873 CDD:206637 33/103 (32%)
Cadherin_repeat 882..994 CDD:206637 22/116 (19%)
Cadherin_repeat 1015..1099 CDD:206637 27/96 (28%)
Cadherin_repeat 1108..1207 CDD:206637 28/108 (26%)
Cadherin_repeat 1215..1314 CDD:206637 21/88 (24%)
Cadherin_repeat 1327..1427 CDD:206637
Cadherin_repeat 1437..1549 CDD:206637
Cadherin_repeat 1557..1662 CDD:206637
PCDHA6NP_061732.1 Cadherin_2 30..111 CDD:285466
Cadherin_repeat 137..238 CDD:206637 27/105 (26%)
Cadherin_repeat 246..346 CDD:206637 34/104 (33%)
Cadherin_repeat 354..451 CDD:206637 22/116 (19%)
Cadherin_repeat 459..561 CDD:206637 27/103 (26%)
Cadherin_repeat 581..670 CDD:206637 26/92 (28%)
Cadherin_tail 799..942 CDD:292596
4 X 4 AA repeats of P-X-X-P 799..894
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 830..950
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7553
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.