DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad87A and PCDHA12

DIOPT Version :9

Sequence 1:NP_731649.2 Gene:Cad87A / 41441 FlyBaseID:FBgn0037963 Length:1975 Species:Drosophila melanogaster
Sequence 2:NP_061726.1 Gene:PCDHA12 / 56137 HGNCID:8666 Length:941 Species:Homo sapiens


Alignment Length:642 Identity:166/642 - (25%)
Similarity:283/642 - (44%) Gaps:93/642 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   652 VVSLRISVTDANDSPPVCESPLYRASVDEGAVVFDSPLIVKARDAD--TMSRISYRIRGSEQVES 714
            |..:.:.|.|.||:|||......:..|.|.|.:.....:..|.|||  ..|.::|.:..:|..|.
Human   116 VFHVDVEVKDINDNPPVFREREQKVPVSESAPLDSHFPLEGASDADIGVNSLLTYALSLNENFEL 180

  Fly   715 IFDIDRETG---QIIIRPNATLDVT-NLNSDQLIFAVEANDGLFTAHCGVNITVRDVNNHVPNFE 775
            .....::..   ::::|.....:.| .||  .|:..::......|....:.|||.|||::.|.|:
Human   181 KIKTKKDKSILPELVLRKLLDREQTPKLN--LLLMVIDGGKPELTGSVQIQITVLDVNDNGPAFD 243

  Fly   776 QQSYSAVVEENSEIGTSVERVHATDLDTGKNAELRYRIQQ----GSFDDFGIVETTGEVFVSRKL 836
            :.||..|:.||.:..|.|.:::|:|.|.|.|.|:.|.|:.    .....|.|...|||:.:..:|
Human   244 KPSYKVVLSENVQNDTRVIQLNASDPDEGLNGEISYGIKMILPVSEKCMFSINPDTGEIRIYGEL 308

  Fly   837 DFDRRNTYQLQIQASDQGTPSLTGTATLTINVQNSNDKDPYFVPATQHAEVRADAPPGQLVYTLI 901
            ||:..|.|::|:.|.|:|.||:.|.:.:.:.|.:.||..|..:..:....|:.||..|.::..:.
Human   309 DFEENNAYEIQVNAIDKGIPSMAGHSMVLVEVLDVNDNVPEVMVTSLSLPVQEDAQVGTVIALIS 373

  Fly   902 ALDPDVANHNALEFAGTDDITAIDKEGKELPH-----YDQFKEYFKISRNGKVSVNKQLDRNLFA 961
            ..|.|...:..:..:.|             ||     ...:|.|:.:      .::..|||...:
Human   374 VSDRDSGANGQVICSLT-------------PHVPFKLVSTYKNYYSL------VLDSALDRESVS 419

  Fly   962 VMRINVLVTDSTAPNVQQGRGLLIIQIIDVNKNPPRFNAPWSVEQPQIKLQMVEEQPVGTVLTTL 1026
            ...:.|...|..:|:: .....:.:::.|||.|.|.|      .||:..:.:.|..|.|..:.|:
Human   420 AYELVVTARDGGSPSL-WATARVSVEVADVNDNAPAF------AQPEYTVFVKENNPPGCHIFTV 477

  Fly  1027 QANDEDSS-------------IGEFNISDNDYFAINQTSGMIYTIARLDYEVVKEVKFQVTVSDT 1078
            .|.|.|:.             :||..:|  .|.:::..||.:|.:..||:|.::.::|||:..|.
Human   478 SAWDADAQKNALVSYSLVERRVGEHALS--SYVSVHAESGKVYALQPLDHEELELLQFQVSARDA 540

  Fly  1079 GVPALTATADVVVDIINLNDNDPKF---SQSDYYFNVTENSPR----GTVAGKVEAHDGDVGVFG 1136
            |||.|.:...:.|.:::.|||.|..   ........|:|..||    |.|..||.|.|.|.|...
Human   541 GVPPLGSNVTLQVFVLDENDNAPALLATPAGSAGGAVSELVPRSVGAGHVVAKVRAVDADSGYNA 605

  Fly  1137 EITYTL----IGENNKYFSIDAYTGNVMVANSSILDREQIKELTLSVVAQDKAPAAVQKSATATI 1197
            .::|.|    :|.:.. |.:..|||.  ::.:.|||........|.|:.:|....|:  ::|||:
Human   606 WLSYELQPAAVGAHIP-FHVGLYTGE--ISTTRILDEADAPRHRLLVLVKDHGEPAL--TSTATV 665

  Fly  1198 HINILDVNDNAPVFTRDVYNSTVAENAAYQPPAALLQVQAIDQDEGLYGDVRYIITA 1254
            .::::: |..||      ..|:.|...|..|.|||:.:..            |:|.|
Human   666 LVSLVE-NGQAP------KTSSRASVGAVDPEAALVDINV------------YLIIA 703

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad87ANP_731649.2 Cadherin_repeat 33..128 CDD:206637
Cadherin_repeat 136..240 CDD:206637
Cadherin_repeat 248..353 CDD:206637
Cadherin_repeat 362..468 CDD:206637
Cadherin_repeat 476..>533 CDD:206637
E_set <627..667 CDD:298831 5/14 (36%)
CA 692..772 CDD:214520 20/85 (24%)
Cadherin_repeat 778..873 CDD:206637 33/98 (34%)
Cadherin_repeat 882..994 CDD:206637 20/116 (17%)
Cadherin_repeat 1015..1099 CDD:206637 27/96 (28%)
Cadherin_repeat 1108..1207 CDD:206637 30/106 (28%)
Cadherin_repeat 1215..1314 CDD:206637 10/40 (25%)
Cadherin_repeat 1327..1427 CDD:206637
Cadherin_repeat 1437..1549 CDD:206637
Cadherin_repeat 1557..1662 CDD:206637
PCDHA12NP_061726.1 Cadherin_2 30..111 CDD:285466
Cadherin_repeat 137..238 CDD:206637 23/102 (23%)
Cadherin_repeat 246..346 CDD:206637 34/99 (34%)
Cadherin_repeat 354..451 CDD:206637 20/116 (17%)
Cadherin_repeat 459..561 CDD:206637 27/103 (26%)
Cadherin_repeat 581..670 CDD:206637 27/93 (29%)
5 X 4 AA repeats of P-X-X-P 734..885
Cadherin_tail 790..933 CDD:292596
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 818..941
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.