DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad87A and PCDHB15

DIOPT Version :9

Sequence 1:NP_731649.2 Gene:Cad87A / 41441 FlyBaseID:FBgn0037963 Length:1975 Species:Drosophila melanogaster
Sequence 2:NP_061758.1 Gene:PCDHB15 / 56121 HGNCID:8686 Length:787 Species:Homo sapiens


Alignment Length:778 Identity:177/778 - (22%)
Similarity:289/778 - (37%) Gaps:223/778 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   709 SEQVESIFDIDRETGQIIIRPNATLDVTNLNSDQLIFAVEANDGLFTAHCG-------------- 759
            ||..|....:|.:|||:|:  |..||...|                   ||              
Human    68 SEDNEQGLQLDLQTGQLIL--NEKLDREKL-------------------CGPTEPCIMHFQVLLK 111

  Fly   760 -------VNITVRDVNNHVPNFEQQSYSAVVEENSEIGTSVERVHATDLDTGKNAELRYRIQQGS 817
                   ..:.|.|:|:|.|.|.::..:..:.|.|.:||......|.|||.|.|....|.|...|
Human   112 K
PLEVFRAELLVTDINDHSPEFPEREMTLKIPETSSLGTVFPLKKARDLDVGSNNVQNYNISPNS 176

  Fly   818 FDDFGI-VETTG------EVFVSRKLDFDRRNTYQLQIQASDQGTPSLTGTATLTINVQNSNDKD 875
              .|.: ..|.|      |:.:..:||.:.:...:|.:.|.|.|:|..:||..:.|.|.::||..
Human   177 --HFHVSTRTRGDGRKYPELVLDTELDREEQAELRLTLTAVDGGSPPRSGTVQILILVLDANDNA 239

  Fly   876 PYFVPATQHAEVRADAPPGQLVYTLIALDPDVANHNALEFAGTDDITAIDKEGKELPHYDQFKEY 940
            |.||.|....:|..::|.|.||..:.|.|.|...:..:.::.......|||.             
Human   240 PEFVQALYEVQVPENSPVGSLVVKVSARDLDTGTNGEISYSLYYSSQEIDKP------------- 291

  Fly   941 FKISR-NGKVSVNKQLDRNLFAVMRINVLVTDSTAPNVQQGRGL-----LIIQIIDVNKNPPRFN 999
            |::|. :|::.:.|:||....:...:::..:|        |.||     :.::::|||.|.|..:
Human   292 FELSSLSGEIRLIKKLDFETMSSYDLDIEASD--------GGGLSGKCSVSVKVLDVNDNFPELS 348

  Fly  1000 APWSVEQPQIKLQMVEEQPVGTVLTTLQANDEDSSIGE-----FNISDNDYFAINQTSGMIY--- 1056
            .. |:..|      :.|....|.:...:..|.||  ||     .:|.|:..|.:..:....|   
Human   349 IS-SLTSP------IPENSPETEVALFRIRDRDS--GENGKMICSIQDDVPFKLKPSVENFYRLV 404

  Fly  1057 TIARLDYEVVKEVKFQVTVSDTGVPALTATADVVVDIINLNDNDPKFSQSDYYFNVTENSPRGTV 1121
            |...||.|...|....:|::|.|.|.|.....:.|.:.::|||.|.|:|:.|...|.||:.....
Human   405 TEGALDRETRAEYNITITITDLGTPRLKTEQSITVLVSDVNDNAPAFTQTSYTLFVRENNSPALH 469

  Fly  1122 AGKVEAHDGDVGVFGEITYTLIGENNKYF------SIDAYTGNVMVANSSILDREQIKELTLSVV 1180
            .|.|.|.|.|.|...::||:|:...:.:.      ||:...|::....|  ||.|.::.....|.
Human   470 IGSVSATDRDSGTNAQVTYSLLPPRDPHLPLTSLVSINTDNGHLFALQS--LDYEALQAFEFRVG 532

  Fly  1181 AQDKAPAAVQKSATATIHINILDVNDNAPVFTRDVYNSTVAENAAYQPPAALLQVQAIDQDEGLY 1245
            |.|:...|:  |:.|.:.:.:||.|||:|.                                   
Human   533 ATDRGFPAL--SSEALVRVLVLDANDNSPF----------------------------------- 560

  Fly  1246 GDVRYIITAGNEMGLFKLDAQSGIVYPAQSLSGKHGAYELTISARDTQGSGTMESTTKAIITVLR 1310
                                   ::||.|                    :|:...|         
Human   561 -----------------------VLYPLQ--------------------NGSAPCT--------- 573

  Fly  1311 VNRHKPEFVIPALSNATIEIPGDIVQPDYLLLTVRAMDNDTEENGKVSYHLQVNNRNEQQTGEFK 1375
                              |:.....:|.||:..|.|:|.|:.:|..:||.|    ....:.|.|.
Human   574 ------------------ELVPRAAEPGYLVTKVVAVDGDSGQNAWLSYQL----LKATEPGLFG 616

  Fly  1376 IDEVTGELRAKTQLNRKNRANYDIILVARDAGNPPFESLRLLSVSIVDANENRPEFPDASNPY 1438
            :....||:|....|:.::.|.:.::::.:|.|.||..:...|.|.:||.         .|.||
Human   617 VWAHNGEVRTARLLSERDVAKHRLVVLVKDNGEPPRSATATLQVLLVDG---------FSQPY 670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad87ANP_731649.2 Cadherin_repeat 33..128 CDD:206637
Cadherin_repeat 136..240 CDD:206637
Cadherin_repeat 248..353 CDD:206637
Cadherin_repeat 362..468 CDD:206637
Cadherin_repeat 476..>533 CDD:206637
E_set <627..667 CDD:298831
CA 692..772 CDD:214520 18/83 (22%)
Cadherin_repeat 778..873 CDD:206637 28/101 (28%)
Cadherin_repeat 882..994 CDD:206637 24/117 (21%)
Cadherin_repeat 1015..1099 CDD:206637 23/91 (25%)
Cadherin_repeat 1108..1207 CDD:206637 29/104 (28%)
Cadherin_repeat 1215..1314 CDD:206637 5/98 (5%)
Cadherin_repeat 1327..1427 CDD:206637 27/99 (27%)
Cadherin_repeat 1437..1549 CDD:206637 2/2 (100%)
Cadherin_repeat 1557..1662 CDD:206637
PCDHB15NP_061758.1 Cadherin_2 30..112 CDD:285466 14/64 (22%)
Cadherin_repeat 137..238 CDD:206637 29/102 (28%)
Cadherin_repeat 247..343 CDD:206637 24/116 (21%)
Cadherin_repeat 356..447 CDD:206637 23/92 (25%)
Cadherin_repeat 455..557 CDD:206637 29/105 (28%)
Cadherin_repeat 576..664 CDD:206637 24/91 (26%)
Cadherin_C_2 685..768 CDD:293101
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.