DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad87A and CDHR4

DIOPT Version :9

Sequence 1:NP_731649.2 Gene:Cad87A / 41441 FlyBaseID:FBgn0037963 Length:1975 Species:Drosophila melanogaster
Sequence 2:XP_016861855.1 Gene:CDHR4 / 389118 HGNCID:34527 Length:841 Species:Homo sapiens


Alignment Length:597 Identity:133/597 - (22%)
Similarity:234/597 - (39%) Gaps:128/597 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   760 VNITVRDVNNHVPNFEQQSYSAVVEENSEIGTSVERVHATDLDTGKNAELRYRIQQ--------- 815
            |.:.|..|.:...:|.:|:.:..:.||...|:.|.:|.|..:|      |||.|..         
Human   274 VIVKVLPVPSSQVSFLEQAQNITIPENLAPGSEVVQVQARGVD------LRYEILSPVPSPLFSI 332

  Fly   816 GSFDDFGIVETTGEVFVSRKLDFDRRNTYQLQIQASDQGTPSLTGTATLTINVQNSNDKDPYFVP 880
            |..|  |:|.||..:.::|.   ......:||::|.:||....:....||:|||..|...|..:|
Human   333 GRAD--GVVRTTTPLELART---SGTAVSRLQVKAFEQGQLWASAKLNLTMNVQLVNLWPPRCLP 392

  Fly   881 ATQHAEVRADAPPGQLVYTLIALDPDVANHNALEFAGTDDITAIDKEGKELPHYDQFKEYFKISR 945
            |...:::...||.|.::.||...||                   |..|..|    .:|.:|:.|.
Human   393 ALLVSQIPETAPVGTVLNTLTCEDP-------------------DSVGATL----DYKLWFRSSS 434

  Fly   946 NGK--------VSVNKQLDRNLFAVM---RINVLVTDSTAPNVQQGRGLLIIQIIDVNKNPPRFN 999
            |..        :.||..||.:.....   ..::||.|...|.:.....:|:: :..:|:..|.. 
Human   435 NPASLCLYDRVLEVNATLDCDTPGACFQHAASILVLDGGQPQMTTEVPVLVM-VTPINEFSPAC- 497

  Fly  1000 APWSVEQPQIKLQMVEEQPVGTVLTTLQANDED---SSIGEFNISDNDYFAINQTSGMIYTIARL 1061
            ||.:       .::.|:....|:|.::...|.|   .:|..:.......||:::.||.::.:..|
Human   498 APRT-------FRVQEDAAPHTLLGSVVGTDMDYPHDNIEYYTSGGPTTFAVDRLSGEVHLLGPL 555

  Fly  1062 DYEVVKEVKFQVTVSDTGVPA-----LTATADVVVDIINLNDN----DPKFSQSDYYFNVTENSP 1117
            |||..:..:..|.|.|.|...     |:.:..:.:::.::||:    :|.|.:...|      :|
Human   556 DYEQQRLYRLTVLVIDHGQDQNPNHHLSGSCTITIEVEDVNDHAPECEPPFQELTIY------AP 614

  Fly  1118 RGTVAGKVEAHDGDVGVFGE-----ITYTLIGEN--NKYFSIDAYTGNVMVANSSILD---REQI 1172
            .|.   .||.......:..|     .:|:::|.|  |::.    ..|.::|.:..:|.   .||.
Human   615 LGR---SVEVTKMSCQIPQEPQRLIYSYSIVGGNSQNRFI----LQGAILVHSDLVLGPFWPEQP 672

  Fly  1173 KELTLSVVAQDKAPAAVQKSATATIHINILDVNDNAPVFTRDVYNSTVAENAAYQPPAALLQVQA 1237
            :...|.:...|..|:....|.||||.:::  |...|.......:.:||...   ..|..:...:|
Human   673 RTYELLICVADAGPSTPHLSTTATIIVHL--VPRRASTVATSTHRTTVPST---MTPMLVTDTEA 732

  Fly  1238 IDQDEGLYGDVRYIITAGNEMGLFKLDAQSGIVY------------PAQSLSGKHGAYELTISAR 1290
            ..|.:..:   ..::||...:.|..|....|.:.            |||:|        |..|.:
Human   733 FWQPQPWF---VVVLTATGALLLLALGWLLGRLLQGLAQLLQAPSKPAQAL--------LLNSIQ 786

  Fly  1291 DTQGS--GTMES 1300
            .|:||  |.:|:
Human   787 GTEGSIEGFLEA 798

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad87ANP_731649.2 Cadherin_repeat 33..128 CDD:206637
Cadherin_repeat 136..240 CDD:206637
Cadherin_repeat 248..353 CDD:206637
Cadherin_repeat 362..468 CDD:206637
Cadherin_repeat 476..>533 CDD:206637
E_set <627..667 CDD:298831
CA 692..772 CDD:214520 3/11 (27%)
Cadherin_repeat 778..873 CDD:206637 28/103 (27%)
Cadherin_repeat 882..994 CDD:206637 24/122 (20%)
Cadherin_repeat 1015..1099 CDD:206637 20/91 (22%)
Cadherin_repeat 1108..1207 CDD:206637 24/108 (22%)
Cadherin_repeat 1215..1314 CDD:206637 21/100 (21%)
Cadherin_repeat 1327..1427 CDD:206637
Cadherin_repeat 1437..1549 CDD:206637
Cadherin_repeat 1557..1662 CDD:206637
CDHR4XP_016861855.1 Cadherin_repeat 294..384 CDD:206637 28/100 (28%)
Cadherin_repeat 398..492 CDD:206637 23/117 (20%)
Cadherin_repeat 499..598 CDD:206637 21/105 (20%)
Cadherin_repeat <638..702 CDD:206637 17/69 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24028
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.