DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad87A and Cdh16

DIOPT Version :9

Sequence 1:NP_731649.2 Gene:Cad87A / 41441 FlyBaseID:FBgn0037963 Length:1975 Species:Drosophila melanogaster
Sequence 2:NP_001012055.1 Gene:Cdh16 / 307614 RGDID:1311638 Length:830 Species:Rattus norvegicus


Alignment Length:712 Identity:168/712 - (23%)
Similarity:267/712 - (37%) Gaps:190/712 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 EGSPVTYGAIGA---DHFSVDPVSGNITLIKPLDREEKDTLKFLVSIRDRVDPEGESERDNVVEV 116
            ||..|..|..|.   :.|:|||.||.:...:.||||||...:..|::        |||...|:..
  Rat    54 EGQIVLSGDSGTAAENTFAVDPDSGFLVATRALDREEKAEYQLQVTL--------ESEDGQVLWG 110

  Fly   117 P--ITFIILDLNDNPPEFQNTPYEADVNEDAAVGTTIFDKITVKDRDIVG-ESLDLKC-----LP 173
            |  :|..:.|.||..|:|....|.|.:::....|.. |..:.|.|.|..| .:.||:.     .|
  Rat   111 PQLVTVHVKDENDQVPQFSQAIYRAQLSQGTRPGVP-FLFLEVSDGDAPGTTNSDLRFHILSQFP 174

  Fly   174 QQQSPEACRKFRLHIIKRDATILEAAVVLNDTLNYNQRMVYHFQIEATDGPHKTQTTFEARVKDV 238
            .|..|:   .|:|     |..:...|:..:.:...:..:..|:|:             ..:|||:
  Rat   175 VQPLPD---MFQL-----DPQLGALALSPDGSTTLDHALEEHYQL-------------LVQVKDM 218

  Fly   239 QDKPPVFQG----SLSTVIDEDSPINTL-------------VLTVHARDGDTGEPRKIVYDLRTN 286
            .|:|...|.    .:|.|.:..:|:..:             :..||...||      :.|.|.:.
  Rat   219 GDQPSGHQAMATLEISIVENSWTPLEPVHLAENLRVAYPHSIAQVHWGGGD------VHYQLESQ 277

  Fly   287 PNDYFLLDAQTGELRTAKPLDREALEDSTGIISLVIRARELVNGVPSDDPLTSATAKATVTIRDV 351
            |...|.:||: |.:.....|||||..:    ..|.:||:. ..|....:||     :..|.:.|.
  Rat   278 PPGPFEVDAE-GRIHVTMELDREAQAE----YQLQVRAQN-SRGEDYAEPL-----ELQVVVMDE 331

  Fly   352 NDSPPVFNHKEYSVSLLENTLPGTPLALDMSVSDADV-------------------GINSKFALR 397
            ||:.||.:..:.::|:.|.:.|||.:| .:|..|.|.                   |..:| |..
  Rat   332 NDNAPVCSPHDPTISIPELSPPGTEVA-RLSAEDLDAPGSPNSHIVYQLLSPEPEQGAENK-AFE 394

  Fly   398 LDDVSGVFDVEPKLVTGYSQVNIRVANGTLDYENPNQRKFIVLVVAEETDTNPRLSSTATITVSV 462
            :|..||                 .|..||... :..|...:.::..:...:...||||..:.|.:
  Rat   395 IDSTSG-----------------SVTLGTAPL-HAGQNILLQVLAVDLAGSEGGLSSTCEVAVMI 441

  Fly   463 LDANDNKPVF-EQESYSASVSEAALPGQYIATITARDVDSGSYGDSGIRYSLSGTGAELFHVNEQ 526
            .|.|::.|.| ..:....|:.|...||..:||:.|.|.|...      .:.|.....|   ..:.
  Rat   442 TDINNHAPEFINSQIGPISLPEDVKPGSLVATLMATDADLEP------AFRLMDFAIE---EGDP 497

  Fly   527 TGVISLANCHDNGESNRRERRDLNEDEHVEEDDGEGHLEMLSMEAATREIGTEPTVQYTLITQAP 591
            ||:..|:...|:.....|.|::|:.:|                         .|..:..::.:..
  Rat   498 TGIFDLSRESDSNHVQLRLRKNLSYEE-------------------------APDHKVVVVVRNV 537

  Fly   592 EEQASSVPLPAPVPHAAPSGVPAATAN-----DDKAPQTCLDYESETT----------YFLSYKA 641
            ||      |..|.|.      |||||.     :...|...||.||..|          ..|:.:.
  Rat   538 EE------LVGPGPG------PAATATVTILVERVIPPLKLDQESYETSIPVSTPAGSLLLTIQP 590

  Fly   642 TDDNGRGSASVVSLRISVTDANDSPP-VC----ESPLYRASVDEGAVVFDS-PLIVKARDAD 697
            :|...|      :||.|:  .|||.. :|    ...:|.|...:||...|: .::|:|:|.|
  Rat   591 SDPMNR------TLRFSL--VNDSEGWLCIKEVSGEVYTAQSLQGAQPGDTYTVLVEAQDTD 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad87ANP_731649.2 Cadherin_repeat 33..128 CDD:206637 26/77 (34%)
Cadherin_repeat 136..240 CDD:206637 22/109 (20%)
Cadherin_repeat 248..353 CDD:206637 27/117 (23%)
Cadherin_repeat 362..468 CDD:206637 26/124 (21%)
Cadherin_repeat 476..>533 CDD:206637 13/56 (23%)
E_set <627..667 CDD:298831 14/49 (29%)
CA 692..772 CDD:214520 3/6 (50%)
Cadherin_repeat 778..873 CDD:206637
Cadherin_repeat 882..994 CDD:206637
Cadherin_repeat 1015..1099 CDD:206637
Cadherin_repeat 1108..1207 CDD:206637
Cadherin_repeat 1215..1314 CDD:206637
Cadherin_repeat 1327..1427 CDD:206637
Cadherin_repeat 1437..1549 CDD:206637
Cadherin_repeat 1557..1662 CDD:206637
Cdh16NP_001012055.1 CA 268..336 CDD:214520 24/84 (29%)
Cadherin_repeat 344..447 CDD:206637 26/122 (21%)
Cadherin_repeat 459..560 CDD:206637 30/146 (21%)
Cadherin_repeat 570..657 CDD:206637 21/83 (25%)
CA 55..126 CDD:214520 26/78 (33%)
Cadherin_repeat 132..236 CDD:206637 26/125 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.