DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad87A and PCDHB1

DIOPT Version :9

Sequence 1:NP_731649.2 Gene:Cad87A / 41441 FlyBaseID:FBgn0037963 Length:1975 Species:Drosophila melanogaster
Sequence 2:NP_037472.2 Gene:PCDHB1 / 29930 HGNCID:8680 Length:818 Species:Homo sapiens


Alignment Length:788 Identity:186/788 - (23%)
Similarity:302/788 - (38%) Gaps:200/788 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   709 SEQVESIFDIDRETGQIIIRPNATLDVTNL--NSDQLI--FAVEANDGL--FTAHCGVNITVRDV 767
            ||..:..|.:.|:||.:.::..  ||..:|  .:|..:  |.|...:.|  |.|    .:.|.|:
Human    68 SEGNKMHFRLHRKTGDLFVKEK--LDRESLCGKADPCVLHFEVVLVEPLQSFRA----EVRVFDI 126

  Fly   768 NNHVPNFEQQSYSAVVEENSEIGTSVERVHATDLDTGKNAELRYRIQQGS-------FDDFGIVE 825
            |::.|.|..:.....:.|::.:|:......|.|||.|.|....|.:....       |...|  .
Human   127 NDNAPVFLNKEPLLKIPESTPLGSRFPLQSAQDLDVGLNGLQNYTLSANGYFHLHTRFCSHG--P 189

  Fly   826 TTGEVFVSRKLDFDRRNTYQLQIQASDQGTPSLTGTATLTINVQNSNDKDPYFVPATQHAEVRAD 890
            ...|:.:::.||.:.:....|.|.|.|.|:|..:|||.:.:.|.:.||..|.|......|:|..:
Human   190 KYAELVLNKPLDREEQPEVNLTITAVDGGSPPKSGTAHIHVVVLDVNDHVPQFSRLVYRAQVSEN 254

  Fly   891 APPGQLVYTLIALDPDVANHNALEFAGTDDITAIDKEGKELPHYDQFKEYFKIS-RNGKVSVNKQ 954
            :|.|.||.|:.|:|.|...:.|:.::...:..||.|.             |:|. :||:|.:...
Human   255 SPNGSLVATVTAVDLDEGTNKAITYSLAQNPEAILKT-------------FQIDPQNGEVRLRGP 306

  Fly   955 LDRNLFAVMRINVLVTDSTAPNVQQGRGL-----LIIQIIDVNKNPPRFNAPWSVEQPQIKLQMV 1014
            ||........|::..||        |.||     ::::::|||.|||..... ||..|     :.
Human   307 LDFEAIETYDIDIQATD--------GGGLSAHSKVLVEVVDVNDNPPEVMVS-SVSSP-----LP 357

  Fly  1015 EEQPVGTVLTTLQANDEDSSIG---EFNISDNDYFAINQTSGMIYTIA---RLDYEVVKEVKFQV 1073
            |:.|..||:......|.|..:|   ...:.::..|.|..|.|..|::.   .||.|.|......:
Human   358 EDSPPQTVVALFTIRDRDIRVGGKVTCFLREDLPFVIKPTFGNSYSLVTDRSLDREEVSGYNITI 422

  Fly  1074 TVSDTGVPALTATADVVVDIINLNDNDPKFSQSDYYFNVTENSPRGTVAGKVEAHDGDVGVFGEI 1138
            ...|||.|:|:|...:.|.|.::|||.|.|.:..|...|.||:......|||.|.|.|:|...:|
Human   423 VAMDTGPPSLSAETMIEVLISDVNDNPPIFREDSYILTVRENNSPAVFIGKVHAEDLDLGENAQI 487

  Fly  1139 TYTLIGENNKYFSIDAY----TGNVMVANSSILDREQIKELTLSVVAQDKAPAAVQKSATATIHI 1199
            ||:|:...|...|:.||    :||..:.....:|.|.|::....|.|.|  ...:..|:..|:.:
Human   488 TYSLLPPKNGDLSVFAYISINSGNGKLYALRTMDYEAIQDFQFVVKATD--GGFLSLSSQVTVRV 550

  Fly  1200 NILDVNDNAPVFTRDVYNSTVAENAAYQPPAALLQVQAIDQDEGLYGDVRYIITAGNEMGLFKLD 1264
            .:||.|||.|:                                                      
Human   551 VVLDDNDNRPM------------------------------------------------------ 561

  Fly  1265 AQSGIVYPAQSLSGKHGAYELTISARDTQGSGTMESTTKAIITVLRVNRHKPEFVIPALSNATIE 1329
                |:||.|                    :||:....                ::|..:.|   
Human   562 ----ILYPLQ--------------------NGTLPCND----------------LVPRSAEA--- 583

  Fly  1330 IPGDIVQPDYLLLTVRAMDNDTEENGKVSYHLQVNNRNEQQTGEFKIDEVTGELRAKTQLNRKNR 1394
                    .||:..|.|:|.|:.:|..:||||    ......|.|.:....||:....|::.::.
Human   584 --------GYLVTKVVAVDGDSGQNSWLSYHL----LKATDLGLFSVQRQNGEIHTLRQISERDP 636

  Fly  1395 ANYDIILVARDAGNPPFESLRLLSVSIVDANENRPEFPDASNPYKVSINENSGRDVKIGHIQAAS 1459
            ....:|::.:|.|.|...:...|::.:||.         .|.||                :|...
Human   637 MMQKLIILVQDHGQPALSTTVSLNILLVDG---------FSEPY----------------LQFQD 676

  Fly  1460 RSKHNRDI 1467
            .:||:|.:
Human   677 PTKHSRKV 684

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad87ANP_731649.2 Cadherin_repeat 33..128 CDD:206637
Cadherin_repeat 136..240 CDD:206637
Cadherin_repeat 248..353 CDD:206637
Cadherin_repeat 362..468 CDD:206637
Cadherin_repeat 476..>533 CDD:206637
E_set <627..667 CDD:298831
CA 692..772 CDD:214520 18/68 (26%)
Cadherin_repeat 778..873 CDD:206637 24/101 (24%)
Cadherin_repeat 882..994 CDD:206637 30/117 (26%)
Cadherin_repeat 1015..1099 CDD:206637 25/89 (28%)
Cadherin_repeat 1108..1207 CDD:206637 32/102 (31%)
Cadherin_repeat 1215..1314 CDD:206637 6/98 (6%)
Cadherin_repeat 1327..1427 CDD:206637 23/99 (23%)
Cadherin_repeat 1437..1549 CDD:206637 6/31 (19%)
Cadherin_repeat 1557..1662 CDD:206637
PCDHB1NP_037472.2 Cadherin_2 30..110 CDD:311943 12/43 (28%)
Cadherin_repeat 140..238 CDD:206637 25/99 (25%)
Cadherin_repeat 246..343 CDD:206637 30/117 (26%)
Cadherin_repeat 356..448 CDD:206637 25/91 (27%)
Cadherin_repeat 456..558 CDD:206637 32/103 (31%)
Cadherin_repeat 577..665 CDD:206637 23/102 (23%)
Cadherin_C_2 688..772 CDD:318652
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 789..818
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.