DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad87A and Pcdha11

DIOPT Version :9

Sequence 1:NP_731649.2 Gene:Cad87A / 41441 FlyBaseID:FBgn0037963 Length:1975 Species:Drosophila melanogaster
Sequence 2:NP_034090.1 Gene:Pcdha11 / 12942 MGIID:1298372 Length:950 Species:Mus musculus


Alignment Length:781 Identity:191/781 - (24%)
Similarity:315/781 - (40%) Gaps:177/781 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   701 RISYRIRGSEQVESIFDIDRETGQIIIRPNATLDVTNL--NSDQLIFAVE--ANDGLFTAHCGVN 761
            |::.:.||     .:.:::.:.|.:.:  |:.:|...|  .|.:....:|  .:..|...|  |.
Mouse    65 RVASKDRG-----DLLEVNLQNGILFV--NSRIDREELCGRSAECSIHLEVIVDRPLQVFH--VE 120

  Fly   762 ITVRDVNNHVPNFEQQSYSAVVEENSEIGTSVERVHATDLDTGKNAELRYRIQQGSFDDFGI--- 823
            :.|||:|::.|.|..:....::.|:.:..:......|:|.|.|:||.|.||:.|..:  |.:   
Mouse   121 VEVRDINDNPPVFPLREQRLLISESKQPDSRFPLEGASDADIGENAVLVYRLSQNEY--FSLEPP 183

  Fly   824 ---VETTGEVFVSRKLDFDRRNTYQLQ--IQASDQGTPSLTGTATLTINVQNSNDKDPYFVPATQ 883
               .:|.....:.:|: .||..|.:|.  :.|:|.|.|.||||..|.:.|.:.||.||.|.....
Mouse   184 INSKQTKRPSLILKKV-LDREKTPELNLLLTATDGGKPELTGTVQLWVRVLDVNDNDPVFDHLEY 247

  Fly   884 HAEVRADAPPGQLVYTLIALDPDVANHNALEFAGTDDITAIDKEGKELPHYDQFKEYFKISRNGK 948
            ...:..:|....||.||.|.|.|...:..|.::    :.:|...|:.|...|:        :||:
Mouse   248 KVRIMENAAKETLVITLNATDLDEGANGQLVYS----LMSIKPTGRHLFTLDE--------KNGE 300

  Fly   949 VSVNKQLDRNLFAVMRINVLVTD-STAPNVQQGRGLLIIQIIDVNKNPPRFNAPWSVEQPQIKLQ 1012
            :.||..||.....:..|.||.|| .|.|.|  |..:::::|:|.|.|.|      .|....:.|.
Mouse   301 LRVNGTLDYEENKLYEIEVLATDKGTPPMV--GHCVVLVEILDTNDNSP------EVTLTSLSLP 357

  Fly  1013 MVEEQPVGTVLTTLQANDEDSSI-GEF--NISDNDYFAINQTSGMIYTI---ARLDYEVVKEVKF 1071
            :.|:....||:..:..:|.||.| |:.  :::.|..|.|..|....|::   :.||.|.|.....
Mouse   358 VREDAQPNTVIALISVSDLDSGINGQVTCSLTPNVPFKIVSTFKNYYSLVLDSSLDRERVSTYDL 422

  Fly  1072 QVTVSDTGVPALTATADVVVDIINLNDNDPKFSQSDYYFNVTENSPRGTVAGKVEAHDGDVGVFG 1136
            .|...|.|.|:|:||..|.|::.::|||.|.|:|.:|...|.||:|.|.....|.|.|.|.....
Mouse   423 VVIARDGGSPSLSATVSVSVEVADVNDNAPVFAQPEYTVFVKENNPPGAHIFTVSAMDADAQENA 487

  Fly  1137 EITYTL----IGEN--NKYFSIDAYTGNVMVANSSILDREQIKELTLSVVAQDKAPAAVQKSATA 1195
            .::|:|    :||.  :.|.|:.|.:|.|.....  ||.|:::.|...|.|:|....|:  .:..
Mouse   488 LVSYSLVERRVGERLLSSYVSVHAESGKVFALQP--LDHEELELLQFQVSARDAGVPAL--GSNV 548

  Fly  1196 TIHINILDVNDNAPVFTRDVYNSTVAENAAYQPPAALLQVQAIDQDEGLYGDVRYIITAGNEMGL 1260
            |:.:.:||.|||||...                                                
Mouse   549 TLQVFVLDENDNAPTLL------------------------------------------------ 565

  Fly  1261 FKLDAQSGIVYPAQSLSGKHGAYELTISARDTQGSGTMESTTKAIITVLRVNRHKPEFVIPALSN 1325
                              .|||.          |:|                            .
Mouse   566 ------------------PHGAV----------GAG----------------------------G 574

  Fly  1326 ATIEIPGDIVQPDYLLLTVRAMDNDTEENGKVSYHLQVNNRNEQQTG----EFKIDEVTGELRAK 1386
            |..|:....|...:::..|||:|.|:..|..:||.:|:.      ||    .|::...|||:...
Mouse   575 AVSELVSRSVGSGHVVTKVRAVDADSGYNAWLSYEVQLG------TGGVRSPFRVGLYTGEISTT 633

  Fly  1387 TQLNRKNRANYDIILVARDAGNPPFESLRLLSVSIVDANENRPEFPDASNPYKVSINENSGRDVK 1451
            ..|:..:.....::::.:|.|.|...:...:.||:|::.:....|..||.  :.|..|.|..||.
Mouse   634 RALDEVDSPRQTLLVLVKDHGEPALTATATVLVSLVESGQAPKSFSQASG--RASAPEASLVDVN 696

  Fly  1452 I 1452
            :
Mouse   697 V 697

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad87ANP_731649.2 Cadherin_repeat 33..128 CDD:206637
Cadherin_repeat 136..240 CDD:206637
Cadherin_repeat 248..353 CDD:206637
Cadherin_repeat 362..468 CDD:206637
Cadherin_repeat 476..>533 CDD:206637
E_set <627..667 CDD:298831
CA 692..772 CDD:214520 16/74 (22%)
Cadherin_repeat 778..873 CDD:206637 28/102 (27%)
Cadherin_repeat 882..994 CDD:206637 31/112 (28%)
Cadherin_repeat 1015..1099 CDD:206637 27/89 (30%)
Cadherin_repeat 1108..1207 CDD:206637 31/104 (30%)
Cadherin_repeat 1215..1314 CDD:206637 5/98 (5%)
Cadherin_repeat 1327..1427 CDD:206637 24/103 (23%)
Cadherin_repeat 1437..1549 CDD:206637 5/16 (31%)
Cadherin_repeat 1557..1662 CDD:206637
Pcdha11NP_034090.1 Cadherin_2 30..111 CDD:285466 9/52 (17%)
Cadherin_repeat 137..238 CDD:206637 29/103 (28%)
Cadherin_repeat 246..345 CDD:206637 31/112 (28%)
Cadherin_repeat 353..450 CDD:206637 28/96 (29%)
Cadherin_repeat 458..560 CDD:206637 31/105 (30%)
Cadherin_repeat 580..669 CDD:206637 22/94 (23%)
Cadherin_tail 799..942 CDD:292596
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7553
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.950

Return to query results.
Submit another query.