DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnali1 and dyla-1

DIOPT Version :9

Sequence 1:NP_650128.1 Gene:Dnali1 / 41440 FlyBaseID:FBgn0037962 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_510720.1 Gene:dyla-1 / 185634 WormBaseID:WBGene00018307 Length:271 Species:Caenorhabditis elegans


Alignment Length:203 Identity:87/203 - (42%)
Similarity:134/203 - (66%) Gaps:16/203 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LDTKRETEEILNSILPPRCWEEDGQLWQQSVSSTPATRQDVINLQEMLDTRLQQTQARETGICPV 115
            ::::.:.:.||:.|||||.:|::|:||:|..|..||||.|:|||:|.|::.|:...|:..||||:
 Worm    60 IESEHQLQLILDCILPPRVYEQNGKLWKQQASLHPATRHDMINLEEKLESELKDRGAKPFGICPI 124

  Fly   116 RRELYSQCFDEIIRQVTINCSERGLLLLRIRDEIAMSMEAYETLYCSSVAFGMRKAL-------Q 173
            ||:||.|.|||:||||:::|.||||||:|:||||.|:..||:.:..|::|:|:||||       :
 Worm   125 RRDLYGQFFDELIRQVSVSCVERGLLLVRVRDEIRMTFAAYQNVLESAIAYGVRKALFIENEQTR 189

  Fly   174 AHEEKEMLRDRVKTLELDKEALEEIIADMKLKQEQAERRNAELRASEEK-KFTEEITFLKKTNAQ 237
            |..|.::.:|:.|.|.|....||:.:|..|:..|:      ||...|:: |.|.|  .|.::|..
 Worm   190 ATTEWKVQKDKNKELHLKIAQLEKKLATDKIVSEE------ELEIVEQRMKDTNE--RLVESNRI 246

  Fly   238 LKAQLEGI 245
            ||.||:.|
 Worm   247 LKNQLQSI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnali1NP_650128.1 Ax_dynein_light 58..239 CDD:402009 82/188 (44%)
dyla-1NP_510720.1 Ax_dynein_light 67..253 CDD:287215 86/193 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158932
Domainoid 1 1.000 148 1.000 Domainoid score I2762
eggNOG 1 0.900 - - E1_KOG4001
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I2954
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56350
OrthoDB 1 1.010 - - D1375694at2759
OrthoFinder 1 1.000 - - FOG0006992
OrthoInspector 1 1.000 - - oto17495
orthoMCL 1 0.900 - - OOG6_103386
Panther 1 1.100 - - LDO PTHR13183
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4201
SonicParanoid 1 1.000 - - X5080
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.800

Return to query results.
Submit another query.