DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl5 and adgrg3

DIOPT Version :9

Sequence 1:NP_001287291.1 Gene:mthl5 / 41438 FlyBaseID:FBgn0037960 Length:497 Species:Drosophila melanogaster
Sequence 2:XP_021333690.1 Gene:adgrg3 / 799479 ZFINID:ZDB-GENE-140106-110 Length:420 Species:Danio rerio


Alignment Length:294 Identity:59/294 - (20%)
Similarity:109/294 - (37%) Gaps:75/294 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 NIVTTIAMCLMVSQAADLVRIFTELTS-----HVSFIVA----------------DIILCFSLLA 293
            ::|..:.:|....|....:.|..:|:|     |:||:.:                .::|.:.|||
Zfish   148 SLVIVLFLCQRKKQCEHSLVIHVQLSSCLFLLHISFLCSVWFSGHSDSDSVCQTIGLLLHWCLLA 212

  Fly   294 AFFWLNSFGFYIWKTF-RSRNVFLRVTDGRKYCYYSAYAWGCTATMAALA----VFAHFFLDAES 353
            .|.|....||:::... |..|::::    |.....|...||.....|.:.    |:..:.|..: 
Zfish   213 TFTWTAIEGFHLYLLLVRVFNIYIK----RYMLKLSLMGWGVPTVTAMICGMTKVYGKYTLYTD- 272

  Fly   354 YKQEHMVGEQ------ETI------GWLGICIFFAPIACTILVNIFFYVTTRKLINRRTVYGRIA 406
              ||:.....      .|:      |:||:.:.|......::|     |..|:|..:..   :|.
Zfish   273 --QENSTATSLCWVTTNTVIYITVNGYLGLVMLFNMAMLAVVV-----VKMRQLRQQNV---QID 327

  Fly   407 HKLKANFIMFSLMLL--VMSIAWLFLIMSWLQMEGLLYA-HIVVNALQTPLLLYICVLRQRHVTF 468
            |:.:|.....||:.|  |:.:.|           ||.:: |   ..|..|.|....:|......|
Zfish   328 HQKRAWKDCVSLLGLCFVLGVPW-----------GLAFSTH---GPLSLPALYVFTILNSFQGVF 378

  Fly   469 ----LLKKTCCYNEPPSANDWGD-ELHYMNGNDY 497
                :|..||...:....:..|. ::.|::..:|
Zfish   379 IFLWILTLTCKARKEKQTSSKGTIQVSYLSNEEY 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl5NP_001287291.1 7tm_4 212..451 CDD:304433 48/241 (20%)
adgrg3XP_021333690.1 GPS 77..118 CDD:307782
7tm_GPCRs 132..393 CDD:333717 56/273 (21%)
TM helix 1 132..156 CDD:320095 1/7 (14%)
TM helix 2 166..187 CDD:320095 6/20 (30%)
TM helix 3 200..222 CDD:320095 6/21 (29%)
TM helix 4 242..258 CDD:320095 4/15 (27%)
TM helix 5 287..310 CDD:320095 5/22 (23%)
TM helix 6 333..358 CDD:320095 8/38 (21%)
TM helix 7 362..387 CDD:320095 5/24 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.