DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl5 and ADGRG6

DIOPT Version :9

Sequence 1:NP_001287291.1 Gene:mthl5 / 41438 FlyBaseID:FBgn0037960 Length:497 Species:Drosophila melanogaster
Sequence 2:XP_006715579.1 Gene:ADGRG6 / 57211 HGNCID:13841 Length:1251 Species:Homo sapiens


Alignment Length:343 Identity:75/343 - (21%)
Similarity:131/343 - (38%) Gaps:59/343 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 CIDKATSSTGEENVLFANICLAR--------KEIKWSDSNFLLR--KILNPIFH---GISLVILL 231
            |:....|...|      .:||..        .::..|.|....|  |:|..|.:   |||.:...
Human   823 CVAHRDSDASE------TVCLCNHFTHFGVLMDLPRSASQLDARNTKVLTFISYIGCGISAIFSA 881

  Fly   232 VIAIIYFILPTLSRDLVGNIVTTIAMCLMVSQAADLV-RIFTELTSHVSFIVADIILCFSLLAAF 295
            ...:.|.....|.||....|:..::..|:......|: ...|........|...::|.|.|||.|
Human   882 ATLLTYVAFEKLRRDYPSKILMNLSTALLFLNLLFLLDGWITSFNVDGLCIAVAVLLHFFLLATF 946

  Fly   296 FWLNSFGFYIW----KTFRSRNVFLRVTDGRKYCYYSAYAWGCTATMAALAVFA---HFFLDAES 353
            .|:.....:::    |.|   |.::|    |....:....||..|.:.::.:.:   :.....||
Human   947 TWMGLEAIHMYIALVKVF---NTYIR----RYILKFCIIGWGLPALVVSVVLASRNNNEVYGKES 1004

  Fly   354 YKQEHMVGE-----QETI-------GWLGICIFFAPIACTILVNIFFYVTTRKLINRRTVYGRIA 406
            |.:|.  |:     |:.:       |:.|: :||..||..|:|.:.......|..| ||:...:.
Human  1005 YGKEK--GDEFCWIQDPVIFYVTCAGYFGV-MFFLNIAMFIVVMVQICGRNGKRSN-RTLREEVL 1065

  Fly   407 HKLKANFIMFSLMLLVMSIAWLFLIMSWLQME-GLLYAHIVVNALQTPLLLYI--CVLRQRHVTF 468
            ..|::   :.||..| :.:.|.|...:|..:. ..:|...:.|:|| .|.::|  |.:::.....
Human  1066 RNLRS---VVSLTFL-LGMTWGFAFFAWGPLNIPFMYLFSIFNSLQ-GLFIFIFHCAMKENVQKQ 1125

  Fly   469 LLKKTCCYNEPPSAN-DW 485
            ..:..||.....:.| ||
Human  1126 WRQHLCCGRFRLADNSDW 1143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl5NP_001287291.1 7tm_4 212..451 CDD:304433 58/264 (22%)
ADGRG6XP_006715579.1 CUB 44..147 CDD:238001
LamG 154..338 CDD:304605
GPS 802..847 CDD:280071 5/29 (17%)
7tm_4 864..1111 CDD:304433 59/262 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.