DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl5 and adgrg11

DIOPT Version :9

Sequence 1:NP_001287291.1 Gene:mthl5 / 41438 FlyBaseID:FBgn0037960 Length:497 Species:Drosophila melanogaster
Sequence 2:XP_017208200.1 Gene:adgrg11 / 563883 ZFINID:ZDB-GENE-041210-320 Length:793 Species:Danio rerio


Alignment Length:341 Identity:62/341 - (18%)
Similarity:108/341 - (31%) Gaps:114/341 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 GLYCIDKATSSTGEENVLFANICLARKEIKWSDSNFLLRKILNPIFHGISLVILLVIAIIYFILP 241
            |:..||..|......|.|......|::.:..|.:.||          |:            |..|
Zfish   369 GVRLIDDPTVLKNYPNALIVPKEAAQQALNQSSNAFL----------GV------------FRFP 411

  Fly   242 TLSR-----DLVGNIVTTIAMCLMVSQAADLVRIFTELTSHVSFIVADIILCFSLLAAFFWLNSF 301
            .:|:     |::.|.|..|.|...:...::.:    .|:.::|...:....|:|      |..:.
Zfish   412 NMSKDANNSDVLNNEVYAIEMGTKIKNLSNTI----NLSFNMSQSTSGTPTCYS------WDGNG 466

  Fly   302 GFYIWKTFRSRNVF-------------------------LRVTDGRKYCYYSAYAWGCTATMAAL 341
            ....|.|...|.|.                         ||.:|.....|.:....|.:.....:
Zfish   467 SKPDWTTEGCRTVVNGSGITCKCEHLTFFAVLMAPPDITLRESDLTALTYITYIGCGLSMFFLGV 531

  Fly   342 AVFAHFFL-DAESYKQEHMVGEQETIGWLGICIFFAPIACTILVNIF---FYVTTRKLINRRTVY 402
            .:|.||.: .|::....|                       :|:|:|   |.:....|.|...|.
Zfish   532 GLFMHFLMRKAKATNSVH-----------------------VLINLFLALFMLNVAFLTNEYVVQ 573

  Fly   403 GR--IAHKLKANFIMFSLMLLVMSIAWLFLIMSWLQMEGLLYAHIVVNALQTPLLLYICVLRQRH 465
            .:  |..::.|.|:.:.|:          ...:|..:|.|   |:.:...:|..|        :|
Zfish   574 AQNSILCRVMAAFLHYCLL----------SSFTWFAVEAL---HLCLQMTKTATL--------KH 617

  Fly   466 VTFLLKKTCCYNEPPS 481
              :|||.|.....||:
Zfish   618 --YLLKITVAGWAPPA 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl5NP_001287291.1 7tm_4 212..451 CDD:304433 45/274 (16%)
adgrg11XP_017208200.1 GPS 457..498 CDD:280071 7/46 (15%)
7tm_4 511..759 CDD:304433 31/167 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.