DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl5 and mthl7

DIOPT Version :9

Sequence 1:NP_001287291.1 Gene:mthl5 / 41438 FlyBaseID:FBgn0037960 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster


Alignment Length:373 Identity:63/373 - (16%)
Similarity:126/373 - (33%) Gaps:145/373 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 SDSNFLLRKILNPIFHGISLVI------------------------------------------- 229
            ||.|:.|.::...||:...|::                                           
  Fly   151 SDFNYFLEEVSIQIFNKCGLIVWFQDGKFWVTVDLFMEKQDYCLYRHNFDSDFPKSMWIIRHRCT 215

  Fly   230 ---------LLVIAIIYFILPTLS--------RDLVGNIVTTIAMCLMVSQAADLVRIFTELTSH 277
                     :|:|.:|.|:| |::        |::.|..:    :|.:||:   .::....:..|
  Fly   216 SHISPGSLEILIITMICFVL-TIAVYLYIKKLRNVTGKCI----VCCIVSR---FIQCLIMILDH 272

  Fly   278 VSFIVADIILC--------FSLLAAFFWLNSFGFYIWKTFRSRNVFLRVTDGRKYCYYSAYAWGC 334
            ::.:..   :|        |..:|:..||:...::.||...|.|   ||....::..|:|:.|..
  Fly   273 LNLLNG---ICSPAGYSSHFFRMASNLWLSVISYHTWKVLTSLN---RVDPNYRFLRYNAFVWST 331

  Fly   335 TATMAALAVFAHFFLDAESYKQEHMVGEQETIGWLGICIFFAPIACTI----------------- 382
            .|.|.......:...:.:..|.          .||.:..|   |.|::                 
  Fly   332 AAIMTGSIYIVNQIWENDPSKW----------NWLPLVGF---IRCSVKDWHPSVWIYISGPSLA 383

  Fly   383 --LVNIFFYVTT----RKL---INRRT--VYGRI--AHKLKANFIMFSLMLLVMSIAWLF----- 429
              ..|:..:..|    ||:   ||:.|  ..|||  .:.....::.|..:.:||.:.|:|     
  Fly   384 LSTFNVAMFALTAIYIRKVKGGINKFTNEEEGRINCINFDSQTYLQFLRLSIVMGLTWIFNVIPY 448

  Fly   430 -----LIMSWLQMEGLL--YAHIVVNALQTPLLLYICVLRQRHVTFLL 470
                 :...|:   |::  |.|....     ::|::.::.:|....|:
  Fly   449 SARLHIFWEWV---GIISEYFHSAFG-----IVLFVLLVLKRSTWTLM 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl5NP_001287291.1 7tm_4 212..451 CDD:304433 57/348 (16%)
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804 7/62 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.