DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl5 and Adgre5

DIOPT Version :9

Sequence 1:NP_001287291.1 Gene:mthl5 / 41438 FlyBaseID:FBgn0037960 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001012164.1 Gene:Adgre5 / 361383 RGDID:1305595 Length:825 Species:Rattus norvegicus


Alignment Length:265 Identity:67/265 - (25%)
Similarity:108/265 - (40%) Gaps:53/265 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 ISLVILLVIAIIYFILPTL--SRDLVGNIVTTIAMCLMVSQAADLVRIFTELTSHVSF---IVAD 284
            :|||.||:..:.:.::..:  ||.:|.   ..:.:||.:.....||.:..| ...|..   :|| 
  Rat   547 LSLVCLLLCILTFLLVKPIQSSRTMVH---LHLCICLFLGSVIFLVGVENE-GGEVGLRCRLVA- 606

  Fly   285 IILCFSLLAAFFWLNSFGFYIWKTFRSRNVFL--RVTDGRKYCYYSAYAWGCTATMAALAVFAHF 347
            ::|.|..||||.|:...|..::        ||  ||..|:....:.....|....:..:|:.|..
  Rat   607 MLLHFCFLAAFCWMALEGVELY--------FLVVRVFQGQGLSTWHRCLVGYGVPLLIVAISAAA 663

  Fly   348 FLDAESYKQEHMVGEQETIGWLG------ICIFFAPIACTILVN-IFFYVTTRKLINRRTVYGRI 405
            .:|...:         .|..||.      :..|..|:|..|..| ..|.:|..||..:.:.....
  Rat   664 RMDGYGH---------ATYCWLDFRKQGFLWSFSGPVAFIIFCNAAIFVITVWKLTKKFSEINPN 719

  Fly   406 AHKL-KANFIMFSLM--LLVMSIAW---LFLI---MSWLQMEGLLYAHIVVNALQTPLLLYI--C 459
            ..|| ||..:..:.:  |||:...|   |||.   .:||.     |...::|.|| .|.||:  |
  Rat   720 MKKLRKARVLTITAIAQLLVLGCTWGFGLFLFNPHSTWLS-----YIFTLLNCLQ-GLFLYVTLC 778

  Fly   460 VLRQR 464
            :|.::
  Rat   779 LLNKK 783

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl5NP_001287291.1 7tm_4 212..451 CDD:304433 60/248 (24%)
Adgre5NP_001012164.1 EGF_CA 69..>101 CDD:214542
EGF_CA 171..218 CDD:284955
EGF_CA 220..265 CDD:284955
GPS 487..526 CDD:280071
7tm_2 534..773 CDD:278432 63/253 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.