| Sequence 1: | NP_001287291.1 | Gene: | mthl5 / 41438 | FlyBaseID: | FBgn0037960 | Length: | 497 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001018317.1 | Gene: | adgrg1 / 324948 | ZFINID: | ZDB-GENE-030131-3671 | Length: | 648 | Species: | Danio rerio |
| Alignment Length: | 208 | Identity: | 42/208 - (20%) |
|---|---|---|---|
| Similarity: | 69/208 - (33%) | Gaps: | 65/208 - (31%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 331 AWGCTATMAALAVFAHFFLDAESYK--QEHMVGEQETIGWLGICIFFAPIACTILVNIFFYVTTR 393
Fly 394 KLINRRTVYGRIAHKLKANFIMFSLMLLVMSI------AWL---------FLIMSWLQMEGLLY- 442
Fly 443 ---------------------------AHIVVN------ALQTPLLLYICVLRQ---------RH 465
Fly 466 VTFL--LKKTCCY 476 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| mthl5 | NP_001287291.1 | 7tmB3_Methuselah-like | 215..474 | CDD:410632 | 39/204 (19%) |
| TM helix 1 | 215..239 | CDD:410632 | |||
| TM helix 2 | 249..271 | CDD:410632 | |||
| TM helix 3 | 281..308 | CDD:410632 | |||
| TM helix 4 | 324..344 | CDD:410632 | 3/12 (25%) | ||
| TM helix 5 | 371..396 | CDD:410632 | 8/24 (33%) | ||
| TM helix 6 | 409..435 | CDD:410632 | 8/40 (20%) | ||
| TM helix 7 | 438..463 | CDD:410632 | 7/58 (12%) | ||
| adgrg1 | NP_001018317.1 | GPS | 312..354 | CDD:460350 | |
| GPS. /evidence=ECO:0000255|PROSITE-ProRule:PRU00098 | 313..361 | ||||
| Stachel. /evidence=ECO:0000255|PROSITE-ProRule:PRU00098 | 349..361 | ||||
| 7tm_GPCRs | 366..620 | CDD:475119 | 42/208 (20%) | ||
| TM helix 1 | 369..393 | CDD:410628 | 4/18 (22%) | ||
| TM helix 2 | 403..424 | CDD:410628 | 5/22 (23%) | ||
| TM helix 3 | 436..458 | CDD:410628 | 3/21 (14%) | ||
| TM helix 4 | 478..492 | CDD:410628 | 3/13 (23%) | ||
| TM helix 5 | 526..549 | CDD:410628 | 4/22 (18%) | ||
| TM helix 6 | 568..590 | CDD:410628 | 5/11 (45%) | ||
| TM helix 7 | 594..619 | CDD:410628 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||