DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl5 and ADGRE2

DIOPT Version :9

Sequence 1:NP_001287291.1 Gene:mthl5 / 41438 FlyBaseID:FBgn0037960 Length:497 Species:Drosophila melanogaster
Sequence 2:XP_011526250.1 Gene:ADGRE2 / 30817 HGNCID:3337 Length:837 Species:Homo sapiens


Alignment Length:294 Identity:60/294 - (20%)
Similarity:120/294 - (40%) Gaps:58/294 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 ICLARKEIKWSDSNFLLRKILNPI-FHGISLVIL-LVIAIIYFILPTLSRDLVGNIVTTIAMCLM 260
            :.:|..:::..|      .:|..| :.|:|:.:| |::|.:.|:|....::...::...:::||.
Human   522 VLMAHYDVQEED------PVLTVITYMGLSVSLLCLLLAALTFLLCKAIQNTSTSLHLQLSLCLF 580

  Fly   261 VSQAADLVRIFTELTSHVSFIVADII---LCFSLLAAFFWLNSFGFYIWKTFR--------SRNV 314
            ::....||.|  :.|.|.  ::..||   |.:..||...|:.....|::.|.|        |.|.
Human   581 LAHLLFLVAI--DQTGHK--VLCSIIAGTLHYLYLATLTWMLLEALYLFLTARNLTVVNYSSINR 641

  Fly   315 FLRVTDGRKYCYYSAYAWGCTATMAALAVFAHFFLDAESYKQEHMVGEQETIGWLG-----ICIF 374
            |:     :|..:...|  |..|...|::          :..:.|:.|..... ||.     |..|
Human   642 FM-----KKLMFPVGY--GVPAVTVAIS----------AASRPHLYGTPSRC-WLQPEKGFIWGF 688

  Fly   375 FAPIACTILVNIFFYVTTRKLINRR--TVYGRIAHKLKANFIMF--SLMLLVMSIAWLFLIMSWL 435
            ..|:.....||:..::.|..::..|  ::...::.......:.|  :..|.::...|...|   |
Human   689 LGPVCAIFSVNLVLFLVTLWILKNRLSSLNSEVSTLRNTRMLAFKATAQLFILGCTWCLGI---L 750

  Fly   436 QM----EGLLYAHIVVNALQ-TPLLLYICVLRQR 464
            |:    ..:.|...::|:|| ..:.|..|:|.|:
Human   751 QVGPAARVMAYLFTIINSLQGVFIFLVYCLLSQQ 784

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl5NP_001287291.1 7tm_4 212..451 CDD:304433 52/264 (20%)
ADGRE2XP_011526250.1 EGF_CA 67..117 CDD:284955
EGF_CA 119..154 CDD:238011
EGF_CA 163..210 CDD:284955
EGF_CA 212..246 CDD:284955
GPS 479..529 CDD:197639 1/6 (17%)
7tm_4 533..774 CDD:304433 55/271 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.