DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl5 and Adgrg5

DIOPT Version :9

Sequence 1:NP_001287291.1 Gene:mthl5 / 41438 FlyBaseID:FBgn0037960 Length:497 Species:Drosophila melanogaster
Sequence 2:XP_008770523.1 Gene:Adgrg5 / 307645 RGDID:1305559 Length:564 Species:Rattus norvegicus


Alignment Length:368 Identity:72/368 - (19%)
Similarity:130/368 - (35%) Gaps:114/368 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 LLRKILNPIFHGISLVILL--VIAIIYFI---LPTLSRDLVGNIVTTIAMCLMVSQAADLVRIFT 272
            |.:.:||..|||.:|.:..  :.::::.:   .|.||  |....:|.::.    :.|...::...
  Rat    52 LEQMLLNASFHGHNLTLQTNSIQSLVFKLSCGFPGLS--LSSATLTNVSQ----AWAPHAMQFPA 110

  Fly   273 ELTSH--VSFIVADI-ILCFSLLAAFFW--------LNSF------------------GFYIWKT 308
            |||.:  |:...|:: ::|.....|..:        ||::                  ....|..
  Rat   111 ELTKNACVTSRPAELRLICVYFFTAHLFQDDRNSSLLNNYVLGAQLDHRPVNNLQRPVNISFWHN 175

  Fly   309 FRSRN------VFLRVTDGRKYCYYSAYAW---GC-TATMAALAVFAH-----FFLDAESYKQEH 358
             ||..      ||.:...|:    :|..||   || |...:...|..|     :|........:.
  Rat   176 -RSLEGYTVTCVFWKEGAGK----HSWGAWSPKGCYTEQPSPTQVLCHCNHLTYFAVLMQLSGDP 235

  Fly   359 MVGEQET----IGWLGICIFFAPIACTILVNIFFYVTTRKLINRRTVYGRIAHKLKANFIMFSLM 419
            :..|.:|    |..:|..|.......|||:|    ..:|||.:..|   ||...|..:.::.::.
  Rat   236 VPTELQTPLEYISLVGCSISIVASLLTILLN----AHSRKLSDSTT---RIHLNLNGSVLLLNIT 293

  Fly   420 LL----------------VMSIAWLFLIMS---WLQMEGL-LYA------HIVVNALQTPL---- 454
            .|                |::....:.::|   |:.:||. ||.      ::.:..:.:||    
  Rat   294 FLLSSQMVPPTVPRSVCTVLAATLHYALLSSLTWMGVEGFNLYLLLGRVYNVYIRRVSSPLGAAS 358

  Fly   455 -------LLYICVLRQRHVTFLLKKTCCYNEPPSANDWGDELH 490
                   :..:|.|      ||.|....|..|...:..|.:.|
  Rat   359 SDDQELSVWTMCDL------FLQKPGKWYRLPECVHVLGTQSH 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl5NP_001287291.1 7tm_4 212..451 CDD:304433 61/316 (19%)
Adgrg5XP_008770523.1 GPS 184..228 CDD:396408 12/47 (26%)
7tm_GPCRs 243..>349 CDD:421689 22/112 (20%)
TM helix 1 243..268 CDD:410628 7/28 (25%)
TM helix 2 277..299 CDD:410628 5/24 (21%)
TM helix 3 311..338 CDD:410628 7/26 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.