DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl5 and Adgrf3

DIOPT Version :9

Sequence 1:NP_001287291.1 Gene:mthl5 / 41438 FlyBaseID:FBgn0037960 Length:497 Species:Drosophila melanogaster
Sequence 2:XP_006239862.1 Gene:Adgrf3 / 298857 RGDID:1305868 Length:992 Species:Rattus norvegicus


Alignment Length:389 Identity:81/389 - (20%)
Similarity:146/389 - (37%) Gaps:102/389 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 DGRLRHYTNAENEAEERHGIQSDYEEDIAGSLEPLYHDY----------DKGLYCIDKATSSTGE 190
            ||  :.:|.||        :..|: ||:.|:|..::.|:          |:|  |..:|.:::..
  Rat   614 DG--QDFTQAE--------VIMDF-EDMNGTLHCVFWDHNAFQGRGGWSDEG--CELQAANASAV 665

  Fly   191 ENVLFANICLARKEIKWS----------DSNFLLRKILNPIFHGISLVILLVIAIIYFILPTLSR 245
            :       |:.|....:|          |.   |..:|:.:..|.|::.|||..:||.:   :.|
  Rat   666 Q-------CVCRHLTAFSILMSQHAVPEDP---LLDLLSQVGVGASILALLVCLVIYRL---VWR 717

  Fly   246 DLVGNIVT--------TIAMCLMVSQAADLVRIFTELTSHVSFIVADIILC-FSLLAAFFWLNSF 301
            .:|.|.|.        .:.:||:|:....|...:.....|....:|...|| |..||.|||:.:.
  Rat   718 VVVRNKVAFFRHTALFNMVICLLVADTCFLGNPWLPSGYHSLVCLATAFLCHFFYLATFFWMLAQ 782

  Fly   302 GFYIWKTFRSRNVFLRVTDGRKYCYYSAYAWGCTATMAALAVFAHFFLDAESYKQEHMVGEQETI 366
            ...:  ..:...||.:::........|...:.|....|.:.:  ..:|....|.:|         
  Rat   783 ALVL--AHQLLFVFHQLSKPLVLSMMSILGYLCPLGFAGVTL--GLYLPQRKYLRE--------- 834

  Fly   367 GWLGICI----------FFAPIACTILVN-IFFYVTTRKLINRRTVYGRIAHKLKANF-IMFSLM 419
               |.|:          |..|:...:.|| :...:...||:......|....|.:|.. ::.:|:
  Rat   835 ---GKCLLSGDGVSLHAFSEPVLAIVSVNGLVLVIAVLKLLRPSLSEGPAVEKRQALVGVLKALL 896

  Fly   420 LL--VMSIAW------LFLIMSWLQMEGLL---YAHIVVNALQTPLLLYICVLRQRHVTFLLKK 472
            :|  :..:.|      ||        ||.|   |..:::|:||...:.....|..:.|...|:|
  Rat   897 ILTPIFGLTWGLGVTTLF--------EGSLVFHYIFVILNSLQGVFIFVFGCLTDKKVLEALRK 952

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl5NP_001287291.1 7tm_4 212..451 CDD:304433 56/270 (21%)
Adgrf3XP_006239862.1 HRM 353..>395 CDD:295297
GPS 632..679 CDD:197639 10/55 (18%)
7tm_4 687..935 CDD:304433 59/277 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.