DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl5 and ADGRD1

DIOPT Version :9

Sequence 1:NP_001287291.1 Gene:mthl5 / 41438 FlyBaseID:FBgn0037960 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001317426.1 Gene:ADGRD1 / 283383 HGNCID:19893 Length:906 Species:Homo sapiens


Alignment Length:376 Identity:79/376 - (21%)
Similarity:154/376 - (40%) Gaps:91/376 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 KATSSTGEENVLFANICLARKEIKWSD--------------------SNFLLRKILNPI------ 221
            :||:|:....|..|.:..:..|..||:                    :||.:...:.|:      
Human   530 EATNSSNRVFVYCAFLDFSSGEGVWSNHGCALTRGNLTYSVCRCTHLTNFAILMQVVPLELARGH 594

  Fly   222 --------FHGISLVILLVIA--IIYFILPTLS--RDLVGNIVTTIAMCLMVSQAADLVRIFTEL 274
                    :.|.||.:|.::|  :.:.:|.::|  |:...:|...::..::|:|...|:....|.
Human   595 QVALSSISYVGCSLSVLCLVATLVTFAVLSSVSTIRNQRYHIHANLSFAVLVAQVLLLISFRLEP 659

  Fly   275 TSHVSFIVADIILCFSLLAAFFWLNSFGFYIW----KTFRSRNVFLRVTDGRKYCYYSAYAWGCT 335
            .:....::| ::|.:..|:||.|:...|.:::    |.|.|        :..|:.||....||..
Human   660 GTTPCQVMA-VLLHYFFLSAFAWMLVEGLHLYSMVIKVFGS--------EDSKHRYYYGMGWGFP 715

  Fly   336 ATMAALAVFAHFFLDAESYKQEHMVGEQETIGWL-----GICIFFAPIACTILVNIFFYVTTRKL 395
            ..:..:::  .|.:|  ||...:..       ||     .|..|.||....|:|||...:...::
Human   716 LLICIISL--SFAMD--SYGTSNNC-------WLSLASGAIWAFVAPALFVIVVNIGILIAVTRV 769

  Fly   396 INRRT-----VYG-RIAHKLKANFIMFSLMLLVMSIAWLFLIMSWLQMEG----LLYAHIVVNAL 450
            |::.:     ::| ..|.||.|..:  :::|.::..:|:|.:   |.:.|    ..|....:|:|
Human   770 ISQISADNYKIHGDPSAFKLTAKAV--AVLLPILGTSWVFGV---LAVNGCAVVFQYMFATLNSL 829

  Fly   451 Q-TPLLLYICVLRQ------RHVTFLLKKTCCYNEPPSANDWGDELHYMNG 494
            | ..:.|:.|:|..      :|.|.:...|.......:|..:..:|  |||
Human   830 QGLFIFLFHCLLNSEVRAAFKHKTKVWSLTSSSARTSNAKPFHSDL--MNG 878

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl5NP_001287291.1 7tm_4 212..451 CDD:304433 57/275 (21%)
ADGRD1NP_001317426.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.