DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl5 and Adgrg2

DIOPT Version :9

Sequence 1:NP_001287291.1 Gene:mthl5 / 41438 FlyBaseID:FBgn0037960 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_852031.1 Gene:Adgrg2 / 266735 RGDID:628618 Length:1013 Species:Rattus norvegicus


Alignment Length:283 Identity:54/283 - (19%)
Similarity:111/283 - (39%) Gaps:33/283 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 GISLVILLVIAIIYFILPTLSRDLVGNIVTTIAMCLMVSQAADLVRIFTELTSHVSFIVA-DIIL 287
            |:|.:.|.|..:.|.....:.||....|:..:...|::.....|:..:..|.:...|.:: .:.|
  Rat   633 GLSSIFLSVTLVTYIAFEKIRRDYPSKILIQLCAALLLLNLVFLLDSWIALYNARGFCISVAVFL 697

  Fly   288 CFSLLAAFFWLNSFGFYIW----KTFRSRNVFLRVTDGRKYCY-YSAYAWGCTATMAALAVFAHF 347
            .:.||.:|.|:....|:::    |.|   |.::     |||.. :....||..|.:.::.:    
  Rat   698 HYFLLVSFTWMGLEAFHMYLALVKVF---NTYI-----RKYILKFCIVGWGIPAVVVSIVL---- 750

  Fly   348 FLDAESY----KQEHMVGEQETIGWL-GICIFFAPIA---CTI-LVNI-FFYVTTRKL--INRRT 400
            .:..::|    ..:...|..:...|: ...:|:..:.   |.| |:|: .|.|...:|  |.::.
  Rat   751 TISPDNYGIGSYGKFPNGTPDDFCWINSSVVFYITVVGYFCVIFLLNVSMFIVVLVQLCRIKKKK 815

  Fly   401 VYGRIAHKLKANFIMFSLMLLVMSIAWLFLIMSWLQME-GLLYAHIVVNALQ-TPLLLYICVLRQ 463
            ..|........:....:.:..::.|.|.|...:|..:. ..:|...:.|.|| ..:.::.|..::
  Rat   816 QLGAQRKTSIQDLRSIAGLTFLLGITWGFAFFAWGPVNLTFMYLFAIFNTLQGFFIFIFYCAAKE 880

  Fly   464 RHVTFLLKKTCCYNEPPSAN-DW 485
            .......:..||.....:.| ||
  Rat   881 NVRKQWRRYLCCGKLRLAENSDW 903

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl5NP_001287291.1 7tm_4 212..451 CDD:304433 46/245 (19%)
Adgrg2NP_852031.1 GPS 566..608 CDD:280071
7tm_4 621..871 CDD:304433 48/249 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.