DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl5 and Adgre5

DIOPT Version :9

Sequence 1:NP_001287291.1 Gene:mthl5 / 41438 FlyBaseID:FBgn0037960 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_036055.2 Gene:Adgre5 / 26364 MGIID:1347095 Length:818 Species:Mus musculus


Alignment Length:266 Identity:66/266 - (24%)
Similarity:107/266 - (40%) Gaps:54/266 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 ISLVILLVIAIIYFILPTL--SRDLVGNIVTTIAMCLMVSQAADLVRIFTELTSHVSF---IVAD 284
            :||:.||:..:.:.::..:  ||.:|.   ..:.:||.:.....||.:..| ...|..   :|| 
Mouse   539 LSLICLLLCILTFLLVKPIQSSRTMVH---LHLCICLFLGSIIFLVGVENE-GGEVGLRCRLVA- 598

  Fly   285 IILCFSLLAAFFWLNSFGFYIWKTFRSRNVFL--RVTDGRKYCYYSAYAWGCTATMAALAV-FAH 346
            ::|.|..||||.|:...|..::        ||  ||..|:....:.....|....:..:|: .|.
Mouse   599 VMLHFCFLAAFCWMALEGVELY--------FLVVRVFQGQGLSTWQRCLIGYGVPLLIVAISMAV 655

  Fly   347 FFLDAESYKQEHMVGEQETIGWLG------ICIFFAPIACTILVN-IFFYVTTRKLINRRTVYGR 404
            ..:|...:         .|..||.      :..|..|:|..|..| ..|.:|..||..:.:....
Mouse   656 VKMDGYGH---------ATYCWLDFRKQGFLWSFSGPVAFIIFCNAAIFVITVWKLTKKFSEINP 711

  Fly   405 IAHKL-KANFIMFS--LMLLVMSIAW---LFLI---MSWLQMEGLLYAHIVVNALQTPLLLYI-- 458
            ...|| ||..:..:  ..|||:...|   |||.   .:||.     |...::|.|| .|.||:  
Mouse   712 NMKKLRKARVLTITSIAQLLVLGCTWGFGLFLFNPHSTWLS-----YIFTLLNCLQ-GLFLYVML 770

  Fly   459 CVLRQR 464
            |:|.::
Mouse   771 CLLNKK 776

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl5NP_001287291.1 7tm_4 212..451 CDD:304433 59/249 (24%)
Adgre5NP_036055.2 EGF_CA 69..118 CDD:284955
EGF_CA 165..212 CDD:284955
EGF_CA 214..248 CDD:284955
GPS 480..518 CDD:280071
7tm_2 526..766 CDD:278432 62/254 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 799..818
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.