DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl5 and mthl12

DIOPT Version :9

Sequence 1:NP_001287291.1 Gene:mthl5 / 41438 FlyBaseID:FBgn0037960 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_731791.2 Gene:mthl12 / 261599 FlyBaseID:FBgn0045442 Length:488 Species:Drosophila melanogaster


Alignment Length:473 Identity:90/473 - (19%)
Similarity:172/473 - (36%) Gaps:157/473 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PNL--------VLVNKCCEKFEIHVDHECQQVNETDYFQPMFTSYGGEQNRPVKF--------KF 106
            |||        ..:..||.:..|..:.||..               |.:|. :|.        ..
  Fly    76 PNLRGCICKVRPCIRICCARKNILSNGECSD---------------GVKNE-IKLTMLDLTMQDI 124

  Fly   107 VIGIPNCGSMQMWPIYHYAGSSDKLVL--------------------LDDGRLRHYTNAENEAEE 151
            ::..|....:.|.|.|:   |::.|:|                    |.||.:..:|:||..:.:
  Fly   125 LLTDPTLAELNMIPQYN---STELLILREQFQPCDEIVSLKRDEYTILKDGSILLHTSAEILSND 186

  Fly   152 RHGIQSDYEEDIAGSLEPLYHDYDKGLYCIDKATSSTGEENVLFANICLARKEIKWSDSNFLLRK 216
            ::.:   |.|        :|.|:.:.:..|:                                |:
  Fly   187 QYCL---YPE--------IYSDFPETIRIIN--------------------------------RR 208

  Fly   217 ILNPIFHGISLVILLVIAIIYFILPT---LSRDLVGNIVTTIAMCLMVSQ-------AADLVRIF 271
            ....:..||:.  |.||:::.|||..   ||.:.:.|::....:|.:.|.       ..|..|:.
  Fly   209 CYRNVMPGIAQ--LSVISVVGFILTLAVYLSVEKLRNLLGKCLICSLFSMFMEYFIWTMDYFRLL 271

  Fly   272 TELTSHVSFIVADIILCFSLLAAFFWLNSFGFYIWKTFRSRNVFLRVTDGRKYCYYSAYAWGCTA 336
            ..:.|     .|..:..|..::::.|.:...|::|:.|.|.|   |.....::..|:.:.| |||
  Fly   272 QSICS-----AAGYMKYFFSMSSYLWFSVVSFHLWELFTSLN---RHEPQYRFLIYNTFVW-CTA 327

  Fly   337 TMAALAVFAHFFLDAESYKQ--EHMVGEQE---TIGWLGICI--------FFAPIACTIL--VNI 386
            .:..:.:|        |..|  |:..|:.|   .:|:.|..:        |::.|...||  .|:
  Fly   328 AIPTVVIF--------SMNQMWENDPGKSEWLPLVGYFGCSVKDWNSSSWFYSHIPIVILNSFNV 384

  Fly   387 FFYVTTRKLI--NRRTVYGRIAHK------LKAN---FIMFSLMLLVMSIAWLFLIMSWLQMEGL 440
            ..:|.|...|  .::.|.....|.      |:.|   :|.|..:.|:|..:||...::.|..:  
  Fly   385 IMFVLTAIYIWKVKKGVKSFAQHDERNTTCLEFNVQTYIQFVRLFLIMGASWLLDQLTRLAED-- 447

  Fly   441 LYAHIVVNALQTPLLLYI 458
              :|::::.:...|.:|:
  Fly   448 --SHLLLDTIVLNLTVYL 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl5NP_001287291.1 7tm_4 212..451 CDD:304433 59/274 (22%)
mthl12NP_731791.2 Methuselah_N 27..209 CDD:284145 30/194 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.