DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl5 and Adgrd1

DIOPT Version :9

Sequence 1:NP_001287291.1 Gene:mthl5 / 41438 FlyBaseID:FBgn0037960 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001074811.1 Gene:Adgrd1 / 243277 MGIID:3041203 Length:903 Species:Mus musculus


Alignment Length:398 Identity:82/398 - (20%)
Similarity:163/398 - (40%) Gaps:104/398 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 EDIAGSLEPLY-----HDYDKGLYCIDKATSSTGEENVLF---ANICLARKEIKWSD-------- 209
            ::::||  ||.     |...:..|     :.:|.|.|.||   |.:..:..|..||.        
Mouse   504 QNLSGS--PLITVHLRHKLTQKQY-----SDATNESNRLFLYCAFLNFSSGEGVWSSQGCALTEG 561

  Fly   210 ------------SNF--LLRKILNPIFHG--------------ISLVILLVIAIIYFILPTLS-- 244
                        :||  |::.:...:.||              :|::.|....:.:.:|.::|  
Mouse   562 NLTYSVCHCTHLTNFAILMQVVPLKLTHGHQVALSSISYVGCSLSVLCLAATLVTFAVLSSVSTI 626

  Fly   245 RDLVGNIVTTIAMCLMVSQAADLVRIFTELTSHVSFIVADIILCFSLLAAFFWLNSFGFYIW--- 306
            |:...:|...::..::|:|...|:. |:.....|...|..::|.:..|.||.|:...|.:::   
Mouse   627 RNQRYHIHANLSFAVLVAQVLLLIS-FSMEPGTVPCQVLAVLLHYFFLTAFAWMLVEGLHLYSMV 690

  Fly   307 -KTFRSRNVFLRVTDGRKYCYYSAYAWGCTATMAALAVFAHFFLDAESYKQEHMVGEQETIGWL- 369
             |.|.|        :..|:.||....|||...:..:::.:    ..:||      |..::. || 
Mouse   691 IKVFGS--------EDSKHLYYYGIGWGCPLLICIISISS----SMDSY------GTSDSC-WLA 736

  Fly   370 ----GICIFFAPIACTILVNIFFYVTTRKLINRRT-----VYG-RIAHKLKANFIMFSLMLLVMS 424
                .|..|..|....|:|||...|...::|:..:     ::| ..|.||.|..:  :::|.::.
Mouse   737 LGSGAIWAFVGPALLVIVVNIVILVAVTRVISHISTDSYKIHGDPSAFKLTAKAV--AVLLPILG 799

  Fly   425 IAWLFLIMSWLQMEGLLYAHI--VVNALQ-TPLLLYICVLRQ------RHVTFLLKKTC----CY 476
            .:|:|.::: :....|::.::  ::|:|| ..:.|:.|:|..      :|.|.:...|.    ..
Mouse   800 TSWVFGVLA-VSDRALVFQYMFAILNSLQGLFIFLFHCLLNSEVRAAFKHKTKVWSLTSSSARTA 863

  Fly   477 NEPPSAND 484
            |..|.::|
Mouse   864 NTKPFSSD 871

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl5NP_001287291.1 7tm_4 212..451 CDD:304433 55/273 (20%)
Adgrd1NP_001074811.1 Laminin_G_3 <173..273 CDD:290121
GPS 539..579 CDD:280071 6/39 (15%)
Stachel. /evidence=ECO:0000250|UniProtKB:Q6QNK2 575..583 3/7 (43%)
7tm_4 595..831 CDD:304433 53/258 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 862..903 3/10 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.