DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl5 and ADGRF2

DIOPT Version :9

Sequence 1:NP_001287291.1 Gene:mthl5 / 41438 FlyBaseID:FBgn0037960 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001355044.1 Gene:ADGRF2 / 222611 HGNCID:18991 Length:708 Species:Homo sapiens


Alignment Length:258 Identity:52/258 - (20%)
Similarity:97/258 - (37%) Gaps:60/258 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 SLVILLVIAIIYF--ILPTLSRDLVGNIVTTIAMCLMVSQAADLVRIFTE--LTSHVSFIVADII 286
            ||::.|.|.::.:  :..|....|....:..||..|:::....:|..|..  :|.|...:.|...
Human   460 SLILCLSIEVLVWSQVTKTEITYLRHVCIVNIAATLLMADVWFIVASFLSGPITHHKGCVAATFF 524

  Fly   287 LCFSLLAAFFWLNS------FGFYIWKTFRSRNVFLRVTDGRKYCYYSAYAWGCTATMAALAVFA 345
            :.|..|:.|||:.:      :|..|        ||..:..........:..:||...:||:.|.|
Human   525 VHFFYLSVFFWMLAKALLILYGIMI--------VFHTLPKSVLVASLFSVGYGCPLAIAAITVAA 581

  Fly   346 ----HFFLDAESYKQEHMVGEQETIGWL------GICIFFAPIACTILVNIFFYVTTRKLI--NR 398
                ..:|..|             |.||      .:..|..|....::||:   :|...:|  .:
Human   582 TEPGKGYLRPE-------------ICWLNWDMTKALLAFVIPALAIVVVNL---ITVTLVIVKTQ 630

  Fly   399 RTVYG-------RIAHKLKANFIMFSLMLLVMSIAWLFLIMSWLQMEGLLYAHIV---VNALQ 451
            |...|       |...::..|   .:::..::.:.|.|.:.:.:....|.: ||:   :||.|
Human   631 RAAIGNSMFQEVRAIVRISKN---IAILTPLLGLTWGFGVATVIDDRSLAF-HIIFSLLNAFQ 689

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl5NP_001287291.1 7tm_4 212..451 CDD:304433 51/256 (20%)
ADGRF2NP_001355044.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.