DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl5 and ADGRG3

DIOPT Version :9

Sequence 1:NP_001287291.1 Gene:mthl5 / 41438 FlyBaseID:FBgn0037960 Length:497 Species:Drosophila melanogaster
Sequence 2:XP_005255899.1 Gene:ADGRG3 / 222487 HGNCID:13728 Length:596 Species:Homo sapiens


Alignment Length:349 Identity:72/349 - (20%)
Similarity:117/349 - (33%) Gaps:97/349 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 CIDKATSSTGEENVLFANICLARKEIKWSDSNFLLRKILNPIFHGISLVILLVIAIIY-FILPTL 243
            |.|..|        .||  .|.|..:..|..:.|.|  ::....|:|::.|....|:| |:.|.|
Human   245 CCDHLT--------FFA--LLLRPTLDQSTVHILTR--ISQAGCGVSMIFLAFTIILYAFLSPGL 297

  Fly   244 SR---------DL-VGNIVTTI-----------------AMCLMVS----QAADLVRIFTELTS- 276
            ..         || .|.|....                 |..|.:|    ::.|..:|...|.. 
Human   298 GHGPHPQQAECDLPAGRIAGPCERGLERQEKLPPAPQGGAWHLRLSRERFKSEDAPKIHVALGGS 362

  Fly   277 ----HVSFIV---------------ADIILCFSLLAAFFWLNSFGFYIW-KTFRSRNVFLRVTDG 321
                :::|:|               ...:..:.||.||.|:....|::: ...|..|.:.    |
Human   363 LFLLNLAFLVNVGSGSKGSDAACWARGAVFHYFLLCAFTWMGLEAFHLYLLAVRVFNTYF----G 423

  Fly   322 RKYCYYSAYAWGCTATMAALAVFAHFFLDAESYKQEHMVGEQETIGWLGICIF---FAPIACTIL 383
            ..:...|...||..|.|.....      .|.||.. :.:.::|....|.:|.|   ....|..|.
Human   424 HYFLKLSLVGWGLPALMVIGTG------SANSYGL-YTIRDRENRTSLELCWFREGTTMYALYIT 481

  Fly   384 VNIFFYVT-----------TRKL--INRRTVYGRIAHKLKANFIMFSLMLLVMSIAWLFLIMSWL 435
            |:.:|.:|           ..|:  ::|.|.........|....:..|..|| .:.|...|.:.|
Human   482 VHGYFLITFLFGMVVLALVVWKIFTLSRATAVKERGKNRKKVLTLLGLSSLV-GVTWGLAIFTPL 545

  Fly   436 QMEGLLYAHIVVNALQTPLLLYIC 459
            .: ..:|...:.|:||.   ::||
Human   546 GL-STVYIFALFNSLQG---VFIC 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl5NP_001287291.1 7tm_4 212..451 CDD:304433 60/307 (20%)
ADGRG3XP_005255899.1 GPS 213..255 CDD:280071 5/19 (26%)
7tm_4 355..564 CDD:304433 44/224 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.