DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl5 and ADGRG5

DIOPT Version :9

Sequence 1:NP_001287291.1 Gene:mthl5 / 41438 FlyBaseID:FBgn0037960 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001291305.1 Gene:ADGRG5 / 221188 HGNCID:19010 Length:528 Species:Homo sapiens


Alignment Length:585 Identity:111/585 - (18%)
Similarity:183/585 - (31%) Gaps:220/585 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 CCALLISLLCVLLLSLNPLPVTSHVTSAGSSTALSSDPNLVLVNKCCEKFEIHVDHECQQVNETD 85
            |.||   .||:.||:|      .:.|:......||...|:.:.......|.....|:.:|:    
Human     4 CGAL---FLCLCLLTL------QNATTETWEELLSYMENMQVSRGRSSVFSSRQLHQLEQM---- 55

  Fly    86 YFQPMFTSYGGEQNRPVKFKFVIGIPNCGSMQMWPIYHYAGSSDKLVLLDDGRLRHYTNAENE-A 149
               .:.||:.|       :...:..|...|:.......::|.|     |....|:....|..: |
Human    56 ---LLNTSFPG-------YNLTLQTPTIQSLAFKLSCDFSGLS-----LTSATLKRVPQAGGQHA 105

  Fly   150 EERHGIQSDYEEDIAGSLEPLYHDYDK------GLYCI---------DKATSSTGEENVLFANI- 198
            ..:|.:|...|         |..|..|      .|.||         |:..||.....||.|.: 
Human   106 RGQHAMQFPAE---------LTRDACKTRPRELRLICIYFSNTHFFKDENNSSLLNNYVLGAQLS 161

  Fly   199 ---------------------------CL-----ARKEIKW-------------SDSNFLLRKIL 218
                                       |:     |||: .|             |.|..|.|  .
Human   162 HGHVNNLRDPVNISFWHNQSLEGYTLTCVFWKEGARKQ-PWGGWSPEGCRTEQPSHSQVLCR--C 223

  Fly   219 NPIFHGISLVIL--------LVIAIIYFILPTLSRDLVGNIVTTIAMCLMVSQAADLVRIFTELT 275
            |.:.:...|:.|        |:..:.|..|...|..:|.:::|.:.......|:..|.||...| 
Human   224 NHLTYFAVLMQLSPALVPAELLAPLTYISLVGCSISIVASLITVLLHFHFRKQSDSLTRIHMNL- 287

  Fly   276 SHVSFIVADI-----------------------ILCFSLLAAFFWLNSFGFYIWKTF-RSRNVFL 316
             |.|.::.:|                       .|.::||:...|:...||.::... |..|:::
Human   288 -HASVLLLNIAFLLSPAFAMSPVPGSACTALAAALHYALLSCLTWMAIEGFNLYLLLGRVYNIYI 351

  Fly   317 RVTDGRKYCY-YSAYAWGCTATMAALAVFAHFFLDAESYKQ--------------EHMVGEQETI 366
                 |:|.: .....||..|.:..|::         |.|.              |:..|.|.  
Human   352 -----RRYVFKLGVLGWGAPALLVLLSL---------SVKSSVYGPCTIPVFDSWENGTGFQN-- 400

  Fly   367 GWLGICIFFAPIACTILV-------NIFFYV-------TTRKLINRR------------TVYGRI 405
              :.||...:|:..::||       ::|..|       |.|:|..|.            ||.|  
Human   401 --MSICWVRSPVVHSVLVMGYGGLTSLFNLVVLAWALWTLRRLRERADAPSVRACHDTVTVLG-- 461

  Fly   406 AHKLKANFIMFSLMLLVMSIAWLFLIMSWLQMEGL-----LYAHIVVNALQ-TPLLLYICVLRQR 464
                         :.:::...|.....|:    |:     |:...::|:|. ..|.|:.|..|.|
Human   462 -------------LTVLLGTTWALAFFSF----GVFLLPQLFLFTILNSLYGFFLFLWFCSQRCR 509

  Fly   465  464
            Human   510  509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl5NP_001287291.1 7tm_4 212..451 CDD:304433 57/316 (18%)
ADGRG5NP_001291305.1 GPS 187..232 CDD:307782 10/47 (21%)
7tmB2_GPR114 245..518 CDD:320559 57/304 (19%)
TM helix 1 247..272 CDD:320559 5/24 (21%)
TM helix 2 281..303 CDD:320559 6/23 (26%)
TM helix 3 315..342 CDD:320559 6/26 (23%)
TM helix 4 355..375 CDD:320559 4/28 (14%)
TM helix 5 409..438 CDD:320559 5/28 (18%)
TM helix 6 451..478 CDD:320559 5/45 (11%)
TM helix 7 482..507 CDD:320559 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.