DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl5 and ADGRE1

DIOPT Version :9

Sequence 1:NP_001287291.1 Gene:mthl5 / 41438 FlyBaseID:FBgn0037960 Length:497 Species:Drosophila melanogaster
Sequence 2:XP_011526096.1 Gene:ADGRE1 / 2015 HGNCID:3336 Length:978 Species:Homo sapiens


Alignment Length:536 Identity:101/536 - (18%)
Similarity:193/536 - (36%) Gaps:125/536 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SLLCVLLLSLNPLPVTS------HVTSAGSSTALSSDPNLVLVNKCCEKFEIHVD---------H 76
            ||..|.|.|:..:.:.|      ::|.|..:..|  |....::||.|.:..:.:|         .
Human   492 SLATVFLESVESMTLASFWKPSANITPAVRTEYL--DIESKVINKECSEENVTLDLVAKGDKMKI 554

  Fly    77 ECQQVNETDYFQP---MFTSYGGEQN----------------RPVKFKF---VIGIPNCGSMQMW 119
            .|..:.|::..:.   .|.|:.|.::                ..:|.|.   |:|....|..:  
Human   555 GCSTIEESESTETTGVAFVSFVGMESVLNERFFKDHQAPLTTSEIKLKMNSRVVGGIMTGEKK-- 617

  Fly   120 PIYHYAGSSDKLVLLDDGRLRHYT--NAENEAEERHGIQSDYEEDIAGSLEPLYHDYDKGLYCID 182
                 .|.||.::         ||  |.:.:.:....|...:..|:.|.....:     |...::
Human   618 -----DGFSDPII---------YTLENIQPKQKFERPICVSWSTDVKGGRWTSF-----GCVILE 663

  Fly   183 KATSSTGEENVLFAN--ICLARKEIKWSDSNFLLRKILNPIFHGISL-VILLVIAIIYFILPTLS 244
            .:.:.|.......||  :.:|..|:....|.:::..:      ||.: ::.||:||..|:|....
Human   664 ASETYTICSCNQMANLAVIMASGELTMDFSLYIISHV------GIIISLVCLVLAIATFLLCRSI 722

  Fly   245 RDLVGNIVTTIAMCLMVSQAADLVRIFTELTSHVSFIVADIILCFSLLAAFFW---------LNS 300
            |:....:...:.:||::::...|..|..........|:|. .|.:..||.|||         |..
Human   723 RNHNTYLHLHLCVCLLLAKTLFLAGIHKTDNKMGCAIIAG-FLHYLFLACFFWMLVEAVILFLMV 786

  Fly   301 FGFYIWKTFRSRNVFLRVTDGRKYCYYSAYAWGCTATMAALAVFAHFFLDAESYKQEHMVGEQET 365
            ....:...|.|||:        |..:..|:.:|    :..|.|.....:..:.|...:..     
Human   787 RNLKVVNYFSSRNI--------KMLHICAFGYG----LPMLVVVISASVQPQGYGMHNRC----- 834

  Fly   366 IGWLG-----ICIFFAPIACTILVNIFFYVTTRKLINRR--TVYGRIAHKLKANFIMFS--LMLL 421
              ||.     |..|..|:...|::|......|..::.:|  :|...::.......:.|.  ..|.
Human   835 --WLNTETGFIWSFLGPVCTVIVINSLLLTWTLWILRQRLSSVNAEVSTLKDTRLLTFKAFAQLF 897

  Fly   422 VMSIAWLFLIMSWLQMEGLL-YAHIVVNALQTPLLLYI-CVL----RQRHVTFLLKKT------- 473
            ::..:|:..|.....:.|:: |...::|:||...:..| |:|    |:.:..::..||       
Human   898 ILGCSWVLGIFQIGPVAGVMAYLFTIINSLQGAFIFLIHCLLNGQVREEYKRWITGKTKPSSQSQ 962

  Fly   474 ---CCYNEPPSANDWG 486
               ...:..|||:..|
Human   963 TSRILLSSMPSASKTG 978

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl5NP_001287291.1 7tm_4 212..451 CDD:304433 49/258 (19%)
ADGRE1XP_011526096.1 EGF_CA 33..62 CDD:238011
EGF_CA 80..114 CDD:214542
EGF_CA 132..171 CDD:214542
EGF_CA 172..206 CDD:214542
EGF_CA 224..260 CDD:214542
EGF_CA 264..297 CDD:214542
EGF_CA 313..>342 CDD:214542
EGF_CA 360..400 CDD:284955
GPS 638..687 CDD:197639 8/53 (15%)
7tm_2 691..932 CDD:278432 52/266 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.