DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl5 and ADGRF3

DIOPT Version :9

Sequence 1:NP_001287291.1 Gene:mthl5 / 41438 FlyBaseID:FBgn0037960 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001138640.1 Gene:ADGRF3 / 165082 HGNCID:18989 Length:1079 Species:Homo sapiens


Alignment Length:294 Identity:64/294 - (21%)
Similarity:114/294 - (38%) Gaps:50/294 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 ILNPIFHGISLVILLVIAIIYFILPTLSRDLVGNIVT--------TIAMCLMVSQAADLVRIFTE 273
            :|..:..|.|::.|||...:|::   :.|.:|.|.::        .:..||:.:....|...|..
Human   772 LLTQVGLGASILALLVCLGVYWL---VWRVVVRNKISYFRHAALLNMVFCLLAADTCFLGAPFLS 833

  Fly   274 LTSHVSFIVADIILC-FSLLAAFFWL--------NSFGFYIWKTFRSRNVFLRVTDGRKYCYYSA 329
            ........:|...|| |..||.|||:        :...|...:..:.|.:.|.|..|        
Human   834 PGPRSPLCLAAAFLCHFLYLATFFWMLAQALVLAHQLLFVFHQLAKHRVLPLMVLLG-------- 890

  Fly   330 YAWGCTATMAALAVFAHFFLDAESYKQEHMVGEQETIGWL-----GICIFFAPIACTILVN-IFF 388
              :.|...:|.:.:  ..:|....|.:|   ||    .||     .:..|..|:...|.|| :..
Human   891 --YLCPLGLAGVTL--GLYLPQGQYLRE---GE----CWLDGKGGALYTFVGPVLAIIGVNGLVL 944

  Fly   389 YVTTRKLINRRTVYGRIAHKLKANF-IMFSLMLL--VMSIAWLFLIMSWLQMEGLL--YAHIVVN 448
            .:...||:......|..|.|.:|.. ::.:|::|  :..:.|...:.:.|:....:  |...::|
Human   945 AMAMLKLLRPSLSEGPPAEKRQALLGVIKALLILTPIFGLTWGLGLATLLEEVSTVPHYIFTILN 1009

  Fly   449 ALQTPLLLYICVLRQRHVTFLLKKTCCYNEPPSA 482
            .||...:|....|..|.:...|:|..|..:.||:
Human  1010 TLQGVFILLFGCLMDRKIQEALRKRFCRAQAPSS 1043

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl5NP_001287291.1 7tm_4 212..451 CDD:304433 54/261 (21%)
ADGRF3NP_001138640.1 HRM 431..477 CDD:280888
GPS 713..758 CDD:280071
7tm_4 770..1016 CDD:304433 56/265 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.