DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl5 and adgre14

DIOPT Version :9

Sequence 1:NP_001287291.1 Gene:mthl5 / 41438 FlyBaseID:FBgn0037960 Length:497 Species:Drosophila melanogaster
Sequence 2:XP_021330419.1 Gene:adgre14 / 108182849 ZFINID:ZDB-GENE-131120-49 Length:505 Species:Danio rerio


Alignment Length:390 Identity:81/390 - (20%)
Similarity:140/390 - (35%) Gaps:116/390 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 EEDIAGSLEPLYHDYDKGLY----------------CIDKATSSTGEENVLFANICLARKEIKWS 208
            |.|.:||...:|.:..|.:.                |:..:|         ||.|...|.....|
Zfish   158 EFDPSGSFSCVYWNISKWIVDGCSVLNTNRSFTVCSCVHLST---------FALIMQTRSHPPES 213

  Fly   209 DSNFLLRKILNPIFHGISLVILLVIAIIYFILPTLSRDLVG-----NIVTTIAMCLMVSQAADLV 268
            ||   |..:||        |:.:::.:::|.|..|:.....     |.|..|.:|:.: ..|.|:
Zfish   214 DS---LLNVLN--------VVCVIVGLLFFSLALLTFTRCQWSPGVNNVARINICISL-LLAHLL 266

  Fly   269 RIFTELTSHVSFIVADIILC--FSLLAAFFWLNSFGFYIWKTFRSRNVFLRVTD----------- 320
            .:.|:  ..:|.|....:||  .|.|..|.:|:.|   :|....:..:|:.|.:           
Zfish   267 FLLTQ--QFLSLIRRQKVLCMLISGLLHFLFLSGF---VWMFIEAVLLFICVKNLSQISSQMKNV 326

  Fly   321 -GRKYCYYSAYAWGCTATMAALAVFAHFFLDAESYKQEHMVGEQETIGWLGICIFFAPIACTILV 384
             ..|......||........:.||..:.:...:.:.|.|.       |:  |..|..|:...|.:
Zfish   327 LRNKLLCVIGYAVALVVVSISAAVVPNGYGSEKCWIQMHK-------GF--IWSFLGPVTIIIAL 382

  Fly   385 NIFFYVTTRKLINRRTVYGRIAHKLKANF---------------IMFSLM--LLVMSIAWL--FL 430
            |:..:::             |...||:.|               :||..:  .:|:..:|:  |.
Zfish   383 NVILFIS-------------IGFSLKSAFKKLNADVSQLNQTKIVMFKTLAQFVVLGCSWILGFF 434

  Fly   431 IMSWLQMEGLLYAHIVVNALQ-TPLLLYICVL----RQRHVTFLLKKTCCYN--EPPSANDWGDE 488
            ..|...:|.|.   :::|:.| |.:.|..|||    ||.:....   |..|:  :|.:.| |..|
Zfish   435 TNSSKVLEILF---LILNSQQGTFIFLIYCVLNKGIRQEYRKLF---TSLYSGLKPKNFN-WSSE 492

  Fly   489  488
            Zfish   493  492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl5NP_001287291.1 7tm_4 212..451 CDD:304433 52/276 (19%)
adgre14XP_021330419.1 GPS 167..205 CDD:197639 7/46 (15%)
7tm_GPCRs 214..476 CDD:333717 62/306 (20%)
TM helix 1 217..241 CDD:320095 6/31 (19%)
TM helix 2 250..271 CDD:320095 5/21 (24%)
TM helix 3 285..307 CDD:320095 6/24 (25%)
TM helix 4 331..347 CDD:320095 2/15 (13%)
TM helix 5 365..388 CDD:320095 7/31 (23%)
TM helix 6 412..435 CDD:320095 5/22 (23%)
TM helix 7 439..464 CDD:320095 8/27 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.