DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl5 and adgrf11

DIOPT Version :9

Sequence 1:NP_001287291.1 Gene:mthl5 / 41438 FlyBaseID:FBgn0037960 Length:497 Species:Drosophila melanogaster
Sequence 2:XP_005160858.1 Gene:adgrf11 / 100537132 ZFINID:ZDB-GENE-121214-165 Length:691 Species:Danio rerio


Alignment Length:345 Identity:77/345 - (22%)
Similarity:123/345 - (35%) Gaps:118/345 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 FLLRKILNPIFH---GISLVILLVIAIIYFILPTLSRDLVGNIV-TTIAMCLMVSQAADLVRIFT 272
            |:..|.|:.|.:   ||| |:.|||::|           :|.|| ||:..    |.:|.| |...
Zfish   368 FIDDKALDYITYTGLGIS-VLSLVISLI-----------IGAIVWTTVTK----SNSAYL-RHVC 415

  Fly   273 ELTSHVSFIVADIILCFSL----------------LAAFFWLNSF--GFYIWKTFRSRNVFLRVT 319
            .:.::||.:|||:  ||.:                .|..|.::.|  .|:.|....:..:....|
Zfish   416 LVNTNVSLLVADV--CFIIGASIVQPGQLAPVGPCTAVAFSMHLFFLAFFFWMLISAMLLLYMTT 478

  Fly   320 DGRKYCYYSAYAWGCTATMAALAVF----AHFFLDAESYKQEHMVGE---QETIGWL------GI 371
                    ..|:....|.|.|:|.|    |...:...:|......|:   :..:.||      .:
Zfish   479 --------MVYSQMSRAKMMAIAFFLGYGAPLLIVVITYGLTAREGKYILEADVCWLNFDETKAL 535

  Fly   372 CIFFAPIACTILVNIFFYVT-------TRKLINRRTVYGRIAHKLKANFI-MFSLMLLVMS---- 424
            .||.:..:....||:...:.       .||..|:.|           |.: ..:.::|::|    
Zfish   536 QIFVSLASSFTAVNVLIIIVVLYKMLIVRKQQNKET-----------NILPTVTRVVLIVSPLFG 589

  Fly   425 IAW----------------LFLIMSWLQ-----MEGLLYAHIVVNALQTPLLLYICVLRQRHVTF 468
            :.|                :|.|::.||     :.|||....|.|||.....|       |:.|.
Zfish   590 VTWGLGIGTMLSPDYGIHLVFTILNSLQGIFNLVSGLLVNSQVRNALAERWSL-------RNFTS 647

  Fly   469 LLKKTCCYNE-----PPSAN 483
            ..:.....||     |||.|
Zfish   648 SNRTRTIQNEQVLFRPPSRN 667

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl5NP_001287291.1 7tm_4 212..451 CDD:304433 67/306 (22%)
adgrf11XP_005160858.1 GAIN 143..>227 CDD:293098
GPS 318..363 CDD:280071
7tm_4 374..620 CDD:304433 59/283 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.