DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6959 and Tpbg

DIOPT Version :9

Sequence 1:NP_001138037.1 Gene:CG6959 / 41434 FlyBaseID:FBgn0037956 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_113995.2 Gene:Tpbg / 83684 RGDID:621453 Length:426 Species:Rattus norvegicus


Alignment Length:400 Identity:109/400 - (27%)
Similarity:157/400 - (39%) Gaps:109/400 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PAACSCGQEMYESEMQYVVNCTNAGLVNTSVLEFMPEQVEVLIFTGNRITELPWNVFGSINNYKQ 96
            ||||.|      ||....|.|.|..|:  .|...:|..|..|..|||::|.||...|........
  Rat    63 PAACEC------SEAARTVKCVNRNLL--EVPADLPPYVRNLFLTGNQMTVLPAGAFARQPPLAD 119

  Fly    97 LRIVDMSSNHIREIRGKSYHHVPRVERLILNHN-------------NLSISR----YEDEVNHHH 144
            |.::::|.||::|:...::.|:|.:.||.|:||             |:|:|.    .|..:||..
  Rat   120 LAVLNLSGNHLKEVGAGAFEHLPGLRRLDLSHNPLTNLSAFTFAGSNVSVSTPSPLLELILNHIV 184

  Fly   145 P----RVFSNFINLQSLHLTDAFEDNSSPQLSEDLHDIFVNSQLVKLQKLHLEQNEITHFKDRNV 205
            |    |...:|..:.      |||...:..|...|       .|..|..|.|..|...:. .|::
  Rat   185 PPEDQRQNGSFEGMV------AFEGMVAAALRSGL-------ALRGLHHLELASNHFLYL-PRDL 235

  Fly   206 FCDLPSLRDLHLGDNDLRDLNF-EVRCLNNLRFLDLERNKFSFVKPTDLRVLNELEERPNRT--- 266
            ...||||:.|.|.:|.|..|.: ..|.|.:|..|.||.|.        |:||:      |.|   
  Rat   236 LDQLPSLKHLDLRNNSLVSLTYASFRNLTHLESLHLEDNA--------LKVLH------NSTLAE 286

  Fly   267 ----ANLIVDFNLNPFGCDCRTAPFRAWITTTRVTVRNKDSLMC-----FHSTGHVDAEPAHLLQ 322
                |::.|..:.||:.|||..|...:|:..|.| |.:|..|.|     ..:.|.:|...:.|  
  Rat   287 WQGLAHVRVFLDNNPWVCDCYMADMVSWLKETEV-VPDKARLTCAFPEKMRNRGLLDLTSSDL-- 348

  Fly   323 MDMGQCADAIAAAATILNTAEDEPHYGDPEASHLQPQAHISGHTATLIFLLIVLTMILLGLLVAL 387
                   |..|.....|.|                          :.:||.|||.  |:|.:..|
  Rat   349 -------DCDATLPQSLQT--------------------------SYVFLGIVLA--LIGAIFLL 378

  Fly   388 V-YVSRDKLK 396
            | |::|..:|
  Rat   379 VLYLNRKGIK 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6959NP_001138037.1 leucine-rich repeat 70..96 CDD:275380 9/25 (36%)
LRR_8 95..161 CDD:290566 21/86 (24%)
leucine-rich repeat 97..120 CDD:275380 6/22 (27%)
LRR_RI <116..>224 CDD:238064 35/128 (27%)
leucine-rich repeat 121..153 CDD:275380 14/52 (27%)
leucine-rich repeat 154..186 CDD:275380 6/31 (19%)
LRR_8 186..245 CDD:290566 21/59 (36%)
leucine-rich repeat 187..211 CDD:275380 6/23 (26%)
leucine-rich repeat 212..234 CDD:275380 8/22 (36%)
leucine-rich repeat 235..258 CDD:275380 8/22 (36%)
TPKR_C2 276..328 CDD:301599 16/56 (29%)
TpbgNP_113995.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..54
LRRNT 62..95 CDD:214470 14/39 (36%)
leucine-rich repeat 73..95 CDD:275380 7/23 (30%)
LRR_8 91..154 CDD:404697 21/62 (34%)
LRR 1 92..113 9/20 (45%)
leucine-rich repeat 96..119 CDD:275380 8/22 (36%)
LRR 2 116..139 5/22 (23%)
leucine-rich repeat 120..143 CDD:275380 6/22 (27%)
LRR 3 141..163 6/21 (29%)
leucine-rich repeat 144..174 CDD:275380 8/29 (28%)
LRR 4 172..210 9/43 (21%)
leucine-rich repeat 175..217 CDD:275380 12/54 (22%)
LRR 5 215..238 6/23 (26%)
LRR_8 216..276 CDD:404697 21/68 (31%)
leucine-rich repeat 218..241 CDD:275380 6/23 (26%)
LRR 6 239..261 9/21 (43%)
leucine-rich repeat 242..265 CDD:275380 8/22 (36%)
LRR 7 262..281 9/32 (28%)
leucine-rich repeat 266..289 CDD:275380 10/36 (28%)
LRRCT 300..351 CDD:214507 17/60 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 85 1.000 Inparanoid score I5074
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D341562at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24364
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
66.030

Return to query results.
Submit another query.