DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6959 and TPBG

DIOPT Version :9

Sequence 1:NP_001138037.1 Gene:CG6959 / 41434 FlyBaseID:FBgn0037956 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001159864.1 Gene:TPBG / 7162 HGNCID:12004 Length:420 Species:Homo sapiens


Alignment Length:375 Identity:106/375 - (28%)
Similarity:160/375 - (42%) Gaps:65/375 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PAACSCGQEMYESEMQYVVNCTNAGLVNTSVLEFMPEQVEVLIFTGNRITELPWNVFGSINNYKQ 96
            ||.|.|      ||....|.|.|..|  |.|...:|..|..|..|||::..||...|.......:
Human    63 PALCEC------SEAARTVKCVNRNL--TEVPTDLPAYVRNLFLTGNQLAVLPAGAFARRPPLAE 119

  Fly    97 LRIVDMSSNHIREIRGKSYHHVPRVERLILNHNNLS-ISRYEDEVNHHHPRVFSNFINLQSLHLT 160
            |..:::|.:.:.|:|..::.|:|.:.:|.|:||.|: :|.:....::......|..:.|...|:.
Human   120 LAALNLSGSRLDEVRAGAFEHLPSLRQLDLSHNPLADLSPFAFSGSNASVSAPSPLVELILNHIV 184

  Fly   161 DAFEDNSSPQLSEDL--HDIFVNSQLVKLQKLHLEQNEITHFKDRNVFCDLPSLRDLHLGDNDLR 223
            .. ||....:..|.:  ..:.....|..|::|.|..|...:. .|:|...|||||.|.|.:|.|.
Human   185 PP-EDERQNRSFEGMVVAALLAGRALQGLRRLELASNHFLYL-PRDVLAQLPSLRHLDLSNNSLV 247

  Fly   224 DLNF-EVRCLNNLRFLDLERNKFSFVKPTDLRVLN-----ELEERPNRTANLIVDFNLNPFGCDC 282
            .|.: ..|.|.:|..|.||.|.        |:||:     ||:..|    ::.|..:.||:.|||
Human   248 SLTYVSFRNLTHLESLHLEDNA--------LKVLHNGTLAELQGLP----HIRVFLDNNPWVCDC 300

  Fly   283 RTAPFRAWITTTRVTVRNKDSLMCFHSTGHVDAEPAHLLQMDMGQCADAIAAAATILNTAEDEPH 347
            ..|....|:..|.| |:.||.|.|        |.|..:....:.:           ||:|:.:  
Human   301 HMADMVTWLKETEV-VQGKDRLTC--------AYPEKMRNRVLLE-----------LNSADLD-- 343

  Fly   348 YGDPEASHLQPQAHISGHTATLIFLLIVLTMILLGLLVALV-YVSRDKLK 396
             .||   .|.|....|     .:||.|||.  |:|.:..|| |::|..:|
Human   344 -CDP---ILPPSLQTS-----YVFLGIVLA--LIGAIFLLVLYLNRKGIK 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6959NP_001138037.1 leucine-rich repeat 70..96 CDD:275380 8/25 (32%)
LRR_8 95..161 CDD:290566 15/66 (23%)
leucine-rich repeat 97..120 CDD:275380 5/22 (23%)
LRR_RI <116..>224 CDD:238064 30/110 (27%)
leucine-rich repeat 121..153 CDD:275380 7/32 (22%)
leucine-rich repeat 154..186 CDD:275380 6/33 (18%)
LRR_8 186..245 CDD:290566 23/59 (39%)
leucine-rich repeat 187..211 CDD:275380 7/23 (30%)
leucine-rich repeat 212..234 CDD:275380 9/22 (41%)
leucine-rich repeat 235..258 CDD:275380 8/27 (30%)
TPKR_C2 276..328 CDD:301599 16/51 (31%)
TPBGNP_001159864.1 LRRNT 61..95 CDD:214470 14/39 (36%)
leucine-rich repeat 73..95 CDD:275380 8/23 (35%)
LRR 1. /evidence=ECO:0000269|PubMed:24582434 92..113 8/20 (40%)
LRR_8 93..154 CDD:338972 18/60 (30%)
leucine-rich repeat 96..119 CDD:275380 7/22 (32%)
LRR 2. /evidence=ECO:0000269|PubMed:24582434 116..139 4/22 (18%)
leucine-rich repeat 120..143 CDD:275380 5/22 (23%)
LRR 3. /evidence=ECO:0000269|PubMed:24582434 141..163 7/21 (33%)
leucine-rich repeat 144..167 CDD:275380 6/22 (27%)
LRR 4. /evidence=ECO:0000269|PubMed:24582434 172..204 6/32 (19%)
leucine-rich repeat 175..211 CDD:275380 6/36 (17%)
LRR 5. /evidence=ECO:0000269|PubMed:24582434 209..232 7/23 (30%)
LRR_8 211..270 CDD:338972 23/67 (34%)
leucine-rich repeat 212..235 CDD:275380 7/23 (30%)
LRR 6. /evidence=ECO:0000269|PubMed:24582434 233..255 10/21 (48%)
leucine-rich repeat 236..259 CDD:275380 9/22 (41%)
LRR 7. /evidence=ECO:0000269|PubMed:24582434 256..275 9/26 (35%)
leucine-rich repeat 260..283 CDD:275380 10/30 (33%)
LRRCT 294..345 CDD:214507 19/73 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5089
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D341562at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24364
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.