DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6959 and trn

DIOPT Version :9

Sequence 1:NP_001138037.1 Gene:CG6959 / 41434 FlyBaseID:FBgn0037956 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster


Alignment Length:560 Identity:111/560 - (19%)
Similarity:178/560 - (31%) Gaps:198/560 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MILVVAIAAIILAIG---AGGVLGENSSSCGPNFPAACSCGQEMYESEMQYVVNCTNAGLVNTSV 62
            ||..|.|..|:.:||   |.|:         .|.|..|.|      .:...||.| ..|.::...
  Fly     6 MIAFVGIWCILASIGVEPAAGL---------ANCPPGCQC------DDNTLVVQC-GEGQLDVLP 54

  Fly    63 LEFMPEQVEVLIFTGNRITELPWNVFGSINNYKQLRIVDMSSNHIREIRGKSYHHVPRVERLILN 127
            :...| .::.|:...|:|.    .:..||..|.:|..:|:||||:..|..:::.:..:::.:.||
  Fly    55 IALNP-SIQRLVIKSNKIK----TIDSSIQFYAELTFLDLSSNHLMTIPQRTFAYQKKLQEVHLN 114

  Fly   128 HNNLS---------------ISRYEDEVNHHHPRVFSNFINLQSLHLTDAFEDNSSPQLSEDLHD 177
            ||.:.               ::...::::..|...|:..:.::.|:|    .:|....|.....|
  Fly   115 HNKIGQISNKTFIGLSAVTVLNLRGNQISELHQGTFTPLLKIEELNL----GENRIGYLDPKAFD 175

  Fly   178 IFVNSQLVKLQKLHLEQNEITHFKDRNVFCDLPSLRDLHLGDNDL--------RDLNFEVRC--- 231
                 .|.:|:.|:|:.|.:|...|..:|..:|||.:|.||.|.|        :||....|.   
  Fly   176 -----GLSQLRILYLDDNALTTVPDPVIFQAMPSLAELFLGMNTLQSIQADAFQDLKGLTRLELK 235

  Fly   232 --------------LNNLRFLDLERNKFSFVKPTDLRVLNELEE--------------------- 261
                          |..||.|||..|:...:....|..|..||:                     
  Fly   236 GASLRNISHDSFLGLQELRILDLSDNRLDRIPSVGLSKLVRLEQLSLGQNDFEVISEGAFMGLKQ 300

  Fly   262 --------------------------------------------------------RPNRTANL- 269
                                                                    :.|...:| 
  Fly   301 LKRLEVNGALRLKRVMTGAFSDNGNLEYLNLSSNKMLLEVQEGALSGLSQLKHVVLKANALTSLA 365

  Fly   270 ----------IVDFNLNPFGCDCRTAPFRAWITTTRVTVRNKDSLMCFHSTGHVDAEPAHLLQMD 324
                      .:|.:.||..||||.......:.....:..:...|:|............||....
  Fly   366 EGLFPWKDLQTLDLSENPLSCDCRVMWLHNLLVAKNASQDDVSELLCEFPERLRGESLRHLNPAM 430

  Fly   325 MGQCADAIAAAATILNTAEDEPHYGDPEASHLQPQAHISGHTATLIFLLIVLTMILLGLLVALVY 389
            || |..|                  ||....| ..|.:.|..||:..|.:||            |
  Fly   431 MG-CTHA------------------DPRKQAL-IGALLVGSAATITALALVL------------Y 463

  Fly   390 VSRDKLKYMIT-PVFDNVA---KKVQY-TSIKDEDCPEVH 424
            ..|.|::..|. .::.|.|   |:.:| .:..|||....|
  Fly   464 RCRHKIRETIKGGLWGNSALGRKEREYQKTFCDEDYMSRH 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6959NP_001138037.1 leucine-rich repeat 70..96 CDD:275380 6/25 (24%)
LRR_8 95..161 CDD:290566 15/80 (19%)
leucine-rich repeat 97..120 CDD:275380 7/22 (32%)
LRR_RI <116..>224 CDD:238064 27/130 (21%)
leucine-rich repeat 121..153 CDD:275380 6/46 (13%)
leucine-rich repeat 154..186 CDD:275380 6/31 (19%)
LRR_8 186..245 CDD:290566 25/83 (30%)
leucine-rich repeat 187..211 CDD:275380 7/23 (30%)
leucine-rich repeat 212..234 CDD:275380 10/46 (22%)
leucine-rich repeat 235..258 CDD:275380 8/22 (36%)
TPKR_C2 276..328 CDD:301599 12/51 (24%)
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 5/21 (24%)
LRR_8 83..142 CDD:290566 11/58 (19%)
leucine-rich repeat 84..107 CDD:275380 7/22 (32%)
leucine-rich repeat 108..131 CDD:275380 4/22 (18%)
LRR_RI 129..421 CDD:238064 48/300 (16%)
LRR_8 132..190 CDD:290566 12/66 (18%)
leucine-rich repeat 132..155 CDD:275380 2/22 (9%)
leucine-rich repeat 156..179 CDD:275380 6/31 (19%)
leucine-rich repeat 180..204 CDD:275380 7/23 (30%)
LRR_8 203..263 CDD:290566 18/59 (31%)
leucine-rich repeat 205..228 CDD:275380 8/22 (36%)
leucine-rich repeat 229..252 CDD:275380 2/22 (9%)
LRR_8 252..308 CDD:290566 10/55 (18%)
leucine-rich repeat 253..276 CDD:275380 8/22 (36%)
leucine-rich repeat 277..300 CDD:275380 2/22 (9%)
leucine-rich repeat 301..322 CDD:275380 0/20 (0%)
LRR_8 325..384 CDD:290566 4/58 (7%)
leucine-rich repeat 326..350 CDD:275380 0/23 (0%)
leucine-rich repeat 351..373 CDD:275380 2/21 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.