DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6959 and CG32055

DIOPT Version :9

Sequence 1:NP_001138037.1 Gene:CG6959 / 41434 FlyBaseID:FBgn0037956 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_729599.1 Gene:CG32055 / 39188 FlyBaseID:FBgn0052055 Length:534 Species:Drosophila melanogaster


Alignment Length:331 Identity:78/331 - (23%)
Similarity:129/331 - (38%) Gaps:89/331 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 YVVNCT---NAGLVNTSV------------LEFMPEQVEVLIFTGNRITELPWNVFGSINNYKQL 97
            |..|.|   ||.|...|:            |..:| ::|.|....|.:..|...:|.::.|   |
  Fly   181 YQENITLGENANLRFLSISNNNLRDFQWCHLRVLP-KLEELHLHSNWLEHLDMGIFYALPN---L 241

  Fly    98 RIVDMSSNHIREIRGKSYHHVPRVERL-ILNHNNLSISRYED-----------------EVNHHH 144
            |::::|:|::.||:...:.....:..| :|::::..:...:|                 ::|..|
  Fly   242 RVLNVSNNNLFEIKRTLFMAPGEIAPLELLDYSSNIVKVLDDSVFCRLKKLRTLNLWLNQINRIH 306

  Fly   145 PRVFSNFINLQSLHLTDAFEDNSSPQLSEDLHDIFVNSQLVKLQKLHLEQNEITH-----FKDR- 203
            ||.|....:||:|||    :.|....|.:   |:|.|  |..|:||.|.:|.|..     |.:| 
  Fly   307 PRAFLGLSSLQTLHL----QGNKISILPD---DVFAN--LTALEKLDLSKNNIQKLGLRVFGERI 362

  Fly   204 -----------NVFCDL--------PSLRDLHLGDNDLRDLNFEVRC-LNNLRFLDLERNKFSFV 248
                       |...||        |.:::|.|..|.|..|:..:.. |..|:.|.:..|:...:
  Fly   363 LRKLIYLDLSNNYIADLHPLALSSMPFIKELRLRRNRLVSLDLRMFAPLRQLQLLTINENRLEEI 427

  Fly   249 KPTDLRV---LNELEERPNR---------TANLIVDFNL----NPFGCDCRTAPFRAWITTTRVT 297
            ....|..   ||.||...||         :.||:...|:    ||:.|.| .....:|:....|:
  Fly   428 DGEILDTLDRLNHLELNNNRLTFLPDLKSSQNLLQLRNITLEGNPWQCLC-LDEITSWLNGRHVS 491

  Fly   298 VRNKDS 303
            .....|
  Fly   492 YARPSS 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6959NP_001138037.1 leucine-rich repeat 70..96 CDD:275380 6/25 (24%)
LRR_8 95..161 CDD:290566 19/83 (23%)
leucine-rich repeat 97..120 CDD:275380 6/22 (27%)
LRR_RI <116..>224 CDD:238064 35/150 (23%)
leucine-rich repeat 121..153 CDD:275380 8/49 (16%)
leucine-rich repeat 154..186 CDD:275380 11/31 (35%)
LRR_8 186..245 CDD:290566 21/84 (25%)
leucine-rich repeat 187..211 CDD:275380 11/48 (23%)
leucine-rich repeat 212..234 CDD:275380 6/22 (27%)
leucine-rich repeat 235..258 CDD:275380 5/25 (20%)
TPKR_C2 276..328 CDD:301599 7/28 (25%)
CG32055NP_729599.1 leucine-rich repeat 76..99 CDD:275380
leucine-rich repeat 100..123 CDD:275380
LRR_8 128..180 CDD:290566
leucine-rich repeat 128..147 CDD:275380
leucine-rich repeat 148..171 CDD:275380
leucine-rich repeat 172..192 CDD:275380 4/10 (40%)
LRR_RI <187..400 CDD:238064 52/225 (23%)
LRR_8 192..251 CDD:290566 14/62 (23%)
leucine-rich repeat 193..216 CDD:275380 4/23 (17%)
leucine-rich repeat 217..240 CDD:275380 5/22 (23%)
leucine-rich repeat 241..267 CDD:275380 6/25 (24%)
leucine-rich repeat 268..291 CDD:275380 3/22 (14%)
LRR_8 290..350 CDD:290566 21/68 (31%)
leucine-rich repeat 292..315 CDD:275380 5/22 (23%)
leucine-rich repeat 316..339 CDD:275380 11/31 (35%)
LRR_8 340..400 CDD:290566 15/59 (25%)
leucine-rich repeat 340..365 CDD:275380 8/24 (33%)
leucine-rich repeat 366..389 CDD:275380 3/22 (14%)
leucine-rich repeat 390..413 CDD:275380 6/22 (27%)
LRR_8 391..448 CDD:290566 15/56 (27%)
leucine-rich repeat 414..437 CDD:275380 4/22 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.