DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6959 and tpbga

DIOPT Version :9

Sequence 1:NP_001138037.1 Gene:CG6959 / 41434 FlyBaseID:FBgn0037956 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_919373.2 Gene:tpbga / 373095 ZFINID:ZDB-GENE-030827-4 Length:372 Species:Danio rerio


Alignment Length:404 Identity:103/404 - (25%)
Similarity:159/404 - (39%) Gaps:77/404 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AIILAIGAGGVLGENSSSCGPNFPAACSCGQEMYESEMQYVVNCTNAGLVNTSVLEFMPEQVEVL 73
            |::|.:.....:...:..|    |..|.|      ||....|.|.:..|  ..:...:|.....|
Zfish     8 AVVLGLLCAAAVSAGALVC----PTGCEC------SEAALTVKCVSKDL--RDIPSGIPGYTRNL 60

  Fly    74 IFTGNRITELPWNVFGSINNYKQLRIVDMSSNHIREIRGKSYHHVPRVERLILNHNNLSISRYED 138
            ..|||.|:::....|..:.|...|   .:|:|.|.|::..::..:..:..|.|::|.|::.    
Zfish    61 FITGNHISQIGPESFQGLENVTNL---SLSNNRISEVKSHTFSSLRSLRSLDLSNNQLAVI---- 118

  Fly   139 EVNHHHPRVFS-NFINLQSLHLTDAFEDNSSPQLSEDLHDIFVNSQLVKLQKLHLEQNEITHFKD 202
                 ||..|: ....|:.|:|:.|..::||..   ||......|.|..|..|.|..|.:. |..
Zfish   119 -----HPEAFTVQSRMLRELNLSRALYNHSSVM---DLATSLRWSSLSDLLVLDLSSNGLV-FLP 174

  Fly   203 RNVFCDLPSLRDLHLGDNDLRDL-NFEVRCLNNLRFLDLERNKFSFVKPTDLRVLNELEERPNRT 266
            ..:||.|..||.|.||:|.:..: |.....|::|:.|||..|....::...|:.|.:|.......
Zfish   175 SGIFCHLVGLRRLQLGNNSIVSIHNGTFTGLDHLQELDLTHNALRTLREEALKELEQLHSARLHL 239

  Fly   267 ANLIVDFNLNPFGCDCRTAPFRAWITTTRVTVRNKDSLMCFHSTGHVDAEPAHLLQMDMGQCADA 331
            |:       |||.|.|...||.||:..:|..|              ||.|..        .||..
Zfish   240 AD-------NPFTCTCDIEPFAAWLNGSRGQV--------------VDIEGL--------TCAFP 275

  Fly   332 IAAAATILNTAEDEPHYGDPEASHLQPQAHISGHTATL------IFLLIVLTMILLGLLVALVYV 390
            :|...|.|.|..|           |:...|.:|.:..|      :||.:||..:.|..|..| |:
Zfish   276 VALHNTSLLTVGD-----------LELGCHKAGDSDNLALQTSYVFLGLVLGFVGLMFLFVL-YL 328

  Fly   391 SRDKLKYMITPVFD 404
            :|..:|..|..:.|
Zfish   329 NRKDIKKRIYDMRD 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6959NP_001138037.1 leucine-rich repeat 70..96 CDD:275380 7/25 (28%)
LRR_8 95..161 CDD:290566 15/66 (23%)
leucine-rich repeat 97..120 CDD:275380 5/22 (23%)
LRR_RI <116..>224 CDD:238064 31/108 (29%)
leucine-rich repeat 121..153 CDD:275380 7/32 (22%)
leucine-rich repeat 154..186 CDD:275380 10/31 (32%)
LRR_8 186..245 CDD:290566 21/59 (36%)
leucine-rich repeat 187..211 CDD:275380 8/23 (35%)
leucine-rich repeat 212..234 CDD:275380 8/22 (36%)
leucine-rich repeat 235..258 CDD:275380 7/22 (32%)
TPKR_C2 276..328 CDD:301599 14/51 (27%)
tpbgaNP_919373.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I5166
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D341562at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24364
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.070

Return to query results.
Submit another query.