DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6959 and Lrrn2

DIOPT Version :10

Sequence 1:NP_650122.1 Gene:CG6959 / 41434 FlyBaseID:FBgn0037956 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001170839.1 Gene:Lrrn2 / 289020 RGDID:1305482 Length:750 Species:Rattus norvegicus


Alignment Length:398 Identity:94/398 - (23%)
Similarity:137/398 - (34%) Gaps:133/398 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PAACSCG-QEMYESEMQY----VVNCTNAGLVNTSVLEFMPEQVEVLIFTGNRITELPWNVFGSI 91
            |..|:|. :..|.....|    .|:|.:  |..|:|...:|...:.|:...|.|:.:.....|.:
  Rat    30 PPQCACQIRPWYTPRSSYREATTVDCND--LFLTAVPPGLPAGTQTLLLQSNSISRIEQTELGYL 92

  Fly    92 NNYKQLRIVDMSSNHIREIRGKSYHHVPRVERLILNHNNLSISRYEDE------------VNHHH 144
            .|..:|   |:|.|...:.|...:..:|::..|.|..|.|  ||.||.            :||:.
  Rat    93 ANLTEL---DLSQNSFSDARDCDFQALPQLLSLHLEENQL--SRLEDHSFAGLTRLQELYLNHNQ 152

  Fly   145 -----PRVFSNFINLQSLHL----------------------------TDAFED-NSSP------ 169
                 ||.|....||..|||                            .||..| |..|      
  Rat   153 LCRISPRAFEGLGNLLRLHLNSNLLRTIDSRWFEMLPNLEILMIGGNKVDAILDMNFRPLANLRS 217

  Fly   170 ---------QLS----EDLHDI----FVNSQLVKLQKLHLEQNEITHFKDRNV----------FC 207
                     ::|    |.|..:    |.::||.::.|..|||.....|.|.|.          |.
  Rat   218 LVLAGMSLREISDYALEGLQSLESLSFYDNQLAQVPKRALEQVPGLKFLDLNKNPLQRVGPGDFA 282

  Fly   208 DLPSLRDLHLGDNDLRDL----NFEVRCLNNLRFLDLERN-KFSFVKP--------TDLRVLNE- 258
            ::..|::  ||.|::.:|    .|.:..|..|..||:..| :.||:.|        .:..:||. 
  Rat   283 NMLHLKE--LGLNNMEELVSIDKFALVNLPELTKLDITNNPRLSFIHPRAFHHLPQMETLMLNNN 345

  Fly   259 ---------LEERPNRTANLIVDFNLNPFGCDCRTAPFRAWITTTRVTVR--NKDSLMCFHSTGH 312
                     :|..||...   |..:.||..|||    ...|...|...||  ...|.:|      
  Rat   346 ALSALHQQTVESLPNLQE---VGLHGNPIRCDC----VIRWANATGTHVRFIEPQSTLC------ 397

  Fly   313 VDAEPAHL 320
              |||..|
  Rat   398 --AEPPDL 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6959NP_650122.1 LRR <69..>278 CDD:443914 69/310 (22%)
leucine-rich repeat 70..96 CDD:275380 5/25 (20%)
leucine-rich repeat 97..120 CDD:275380 5/22 (23%)
leucine-rich repeat 121..153 CDD:275380 13/48 (27%)
leucine-rich repeat 154..186 CDD:275380 15/83 (18%)
leucine-rich repeat 187..211 CDD:275380 8/33 (24%)
leucine-rich repeat 212..234 CDD:275380 7/25 (28%)
leucine-rich repeat 235..258 CDD:275380 8/31 (26%)
LRRCT 276..328 CDD:214507 15/47 (32%)
Lrrn2NP_001170839.1 LRRNT 28..72 CDD:214470 11/43 (26%)
leucine-rich repeat 51..69 CDD:275380 5/19 (26%)
leucine-rich repeat 71..94 CDD:275380 4/22 (18%)
LRR <85..>324 CDD:443914 56/245 (23%)
leucine-rich repeat 95..118 CDD:275380 5/25 (20%)
leucine-rich repeat 119..142 CDD:275380 8/24 (33%)
leucine-rich repeat 143..166 CDD:275380 5/22 (23%)
leucine-rich repeat 167..190 CDD:275380 4/22 (18%)
leucine-rich repeat 191..214 CDD:275380 5/22 (23%)
leucine-rich repeat 215..238 CDD:275380 3/22 (14%)
leucine-rich repeat 239..262 CDD:275380 7/22 (32%)
leucine-rich repeat 263..286 CDD:275380 4/22 (18%)
leucine-rich repeat 287..311 CDD:275380 7/25 (28%)
LRR_8 310..371 CDD:404697 14/63 (22%)
leucine-rich repeat 312..334 CDD:275380 7/21 (33%)
leucine-rich repeat 337..360 CDD:275378 3/22 (14%)
PCC 342..>420 CDD:188093 21/77 (27%)
leucine-rich repeat 361..373 CDD:275378 3/14 (21%)
Ig 430..514 CDD:472250
Ig strand B 441..445 CDD:409353
Ig strand C 454..458 CDD:409353
Ig strand E 480..484 CDD:409353
Ig strand F 494..499 CDD:409353
Ig strand G 507..510 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.