DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6959 and Lrrn2

DIOPT Version :10

Sequence 1:NP_650122.1 Gene:CG6959 / 41434 FlyBaseID:FBgn0037956 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_034862.1 Gene:Lrrn2 / 16980 MGIID:106037 Length:730 Species:Mus musculus


Alignment Length:493 Identity:109/493 - (22%)
Similarity:170/493 - (34%) Gaps:171/493 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IAAIILAIGAGGVLGENSSSCGP------NFPAACSCG-QEMYESEMQY----VVNCTNAGLVNT 60
            :||::|:..||      :::..|      ..|..|:|. :..|.....|    .|:|.:  |..|
Mouse     5 VAALLLSWVAG------TTAAAPVVPWRVPCPPQCACQIRPWYTPRSSYREATTVDCND--LFLT 61

  Fly    61 SVLEFMPEQVEVLIFTGNRITELPWNVFGSINNYKQLRIVDMSSNHIREIRGKSYHHVPRVERLI 125
            :|...:|...:.|:...|.|:.:.......:.|..:|   |:|.|...:.|...:..:|::..|.
Mouse    62 AVPPRLPAGTQTLLLQSNSISRIDQTELAYLANLTEL---DLSQNSFSDARDCDFQALPQLLSLH 123

  Fly   126 LNHNNLSISRYEDE------------VNHHH-----PRVFSNFINLQSLHL-------------- 159
            |..|.|  :|.||.            :||:.     ||.|:...||..|||              
Mouse   124 LEENRL--NRLEDHSFAGLTSLQELYLNHNQLCRISPRAFAGLGNLLRLHLNSNLLRTIDSRWFE 186

  Fly   160 --------------TDAFED-NSSP---------------QLS----EDLHDI----FVNSQLVK 186
                          .||..| |..|               ::|    |.|..:    |.::||.:
Mouse   187 MLPNLEILMIGGNKVDAILDMNFRPLANLRSLVLAGMSLREISDYALEGLQSLESLSFYDNQLAQ 251

  Fly   187 LQKLHLEQNEITHFKDRNV----------FCDLPSLRDLHLGDNDLRDL----NFEVRCLNNLRF 237
            :.|..|||.....|.|.|.          |.::..|::  ||.|::.:|    .|.:..|..|..
Mouse   252 VPKRALEQVPGLKFLDLNKNPLQRVGPGDFANMLHLKE--LGLNNMEELVSIDKFALVNLPELTK 314

  Fly   238 LDLERN-KFSFVKP--------TDLRVLNE----------LEERPNRTANLIVDFNLNPFGCDCR 283
            ||:..| :.||:.|        .:..:||.          :|..||...   |..:.||..||| 
Mouse   315 LDITNNPRLSFIHPRAFHHLPQMETLMLNNNALSALHQQTVESLPNLQE---VGLHGNPIRCDC- 375

  Fly   284 TAPFRAWITTTRVTVR--NKDSLMCFHSTGHVDAEPAHLLQMDMGQ---------CADAI----- 332
               ...|...|...||  ...|.:|        |||..|.:..:.:         |...|     
Mouse   376 ---VIRWANATGTHVRFIEPQSTLC--------AEPPDLQRRPVREVPFREMTDHCLPLISPRSF 429

  Fly   333 -------AAAATILN---TAEDEP--HYGDPEASHLQP 358
                   :..:|:|:   .||.||  ::..|....|.|
Mouse   430 PSSLQIASGESTVLHCRALAEPEPEIYWVTPAGVRLTP 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6959NP_650122.1 LRR <69..>278 CDD:443914 67/310 (22%)
leucine-rich repeat 70..96 CDD:275380 4/25 (16%)
leucine-rich repeat 97..120 CDD:275380 5/22 (23%)
leucine-rich repeat 121..153 CDD:275380 12/48 (25%)
leucine-rich repeat 154..186 CDD:275380 15/83 (18%)
leucine-rich repeat 187..211 CDD:275380 8/33 (24%)
leucine-rich repeat 212..234 CDD:275380 7/25 (28%)
leucine-rich repeat 235..258 CDD:275380 8/31 (26%)
LRRCT 276..328 CDD:214507 15/62 (24%)
Lrrn2NP_034862.1 LRRNT 28..72 CDD:214470 11/45 (24%)
leucine-rich repeat 51..69 CDD:275380 5/19 (26%)
leucine-rich repeat 71..94 CDD:275380 3/22 (14%)
LRR <85..>324 CDD:443914 54/245 (22%)
leucine-rich repeat 95..118 CDD:275380 5/25 (20%)
leucine-rich repeat 119..142 CDD:275380 7/24 (29%)
leucine-rich repeat 143..166 CDD:275380 5/22 (23%)
leucine-rich repeat 167..190 CDD:275380 4/22 (18%)
leucine-rich repeat 191..214 CDD:275380 5/22 (23%)
leucine-rich repeat 215..238 CDD:275380 3/22 (14%)
leucine-rich repeat 239..262 CDD:275380 7/22 (32%)
leucine-rich repeat 263..286 CDD:275380 4/22 (18%)
leucine-rich repeat 287..311 CDD:275380 7/25 (28%)
LRR_8 310..371 CDD:404697 14/63 (22%)
leucine-rich repeat 312..334 CDD:275380 7/21 (33%)
leucine-rich repeat 337..360 CDD:275378 3/22 (14%)
PCC 342..>420 CDD:188093 21/92 (23%)
leucine-rich repeat 361..373 CDD:275378 3/14 (21%)
Ig 430..514 CDD:472250 9/38 (24%)
Ig strand B 441..445 CDD:409421 2/3 (67%)
Ig strand C 454..458 CDD:409421 0/3 (0%)
Ig strand E 480..484 CDD:409421
Ig strand F 494..499 CDD:409421
Ig strand G 507..510 CDD:409421
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.