DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6959 and Tpbgl

DIOPT Version :9

Sequence 1:NP_001138037.1 Gene:CG6959 / 41434 FlyBaseID:FBgn0037956 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001182458.1 Gene:Tpbgl / 100503386 MGIID:3646425 Length:384 Species:Mus musculus


Alignment Length:392 Identity:86/392 - (21%)
Similarity:130/392 - (33%) Gaps:128/392 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PNFPAACSCGQEMYESEMQYVVNCTNAGLV--NTSVL---------EFMPEQVEVLIFTGNRITE 82
            |.....|:.|.|:.:.......:..|..:|  |.:||         |...:.|.:.:.|..|:|.
Mouse    41 PRLMLRCASGAELRQPPRDVPPDARNLTIVGANLTVLRAAAFAGGGEGATDGVRLPLLTALRLTH 105

  Fly    83 LPWNVFGSINNYKQLRIVDMSSNHIREIRGKSYHHVPRVERLILNHNNLSISRYEDEVNHHHPRV 147
                                  |:|..:...::..:|.:..|.|:||.|....|         |.
Mouse   106 ----------------------NNIEVVEDGAFDGLPSLAALDLSHNPLRALGY---------RA 139

  Fly   148 FSNFINLQSLHLTDAFEDNSSPQLSEDLHDIFVNSQLVKLQKLHLEQNEITHFKDRNVFCDLPSL 212
            |.....|:||.|..|.. ..||.:.:.|     ::.|..|.:|.|                    
Mouse   140 FRGLPALRSLQLNHALA-RGSPGMLDAL-----DAALAPLAELRL-------------------- 178

  Fly   213 RDLHLGDNDLRDLNFEVRCLNNLRFLDLERNKFSFVKPTDLRVLNELEERPNRTANLIVDFNLNP 277
              |.|..|.|..|......|..|..||...|..:.:.|.:|..|....:.| :...|:.|   ||
Mouse   179 --LGLVGNALSRLPLAALRLPRLEQLDARVNALAGLGPDELSALERDGDLP-QPRLLLAD---NP 237

  Fly   278 FGCDCRTAPFRAWITTTRVTVRNKDSLMCFHSTGHVDAEPAHLLQ---MDMGQ----CADAIAAA 335
            ..|.|.:.|..||:......|.:...|.|        |.|..||.   :|:.:    |:|     
Mouse   238 LSCGCTSRPLLAWLHNATERVPDARRLRC--------ASPRVLLDRPLIDLDEARLGCSD----- 289

  Fly   336 ATILNTAEDEPHYGDPEASHLQPQAHISGH---------TATLIFLLIVLTMILLGLLVALV-YV 390
                         ||         ||.||.         .|:.:|..:||.  |:||:..:| |:
Mouse   290 -------------GD---------AHESGEGIDVAGPELEASYVFFGLVLA--LIGLIFLMVLYL 330

  Fly   391 SR 392
            :|
Mouse   331 NR 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6959NP_001138037.1 leucine-rich repeat 70..96 CDD:275380 4/25 (16%)
LRR_8 95..161 CDD:290566 15/65 (23%)
leucine-rich repeat 97..120 CDD:275380 2/22 (9%)
LRR_RI <116..>224 CDD:238064 25/107 (23%)
leucine-rich repeat 121..153 CDD:275380 8/31 (26%)
leucine-rich repeat 154..186 CDD:275380 9/31 (29%)
LRR_8 186..245 CDD:290566 13/58 (22%)
leucine-rich repeat 187..211 CDD:275380 3/23 (13%)
leucine-rich repeat 212..234 CDD:275380 6/21 (29%)
leucine-rich repeat 235..258 CDD:275380 7/22 (32%)
TPKR_C2 276..328 CDD:301599 15/58 (26%)
TpbglNP_001182458.1 LRR 1 61..84 5/22 (23%)
LRR 2 95..118 5/44 (11%)
LRR_8 96..153 CDD:290566 18/87 (21%)
leucine-rich repeat 98..121 CDD:275378 5/44 (11%)
LRR 3 119..142 9/31 (29%)
leucine-rich repeat 122..145 CDD:275378 8/31 (26%)
leucine-rich repeat 146..198 CDD:275378 18/79 (23%)
LRR 4 173..196 8/44 (18%)
LRR 5 198..219 6/20 (30%)
leucine-rich repeat 199..219 CDD:275378 6/19 (32%)
leucine-rich repeat 220..240 CDD:275378 6/23 (26%)
LRRCT 236..288 CDD:214507 15/59 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 361..384
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I5148
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24364
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
44.020

Return to query results.
Submit another query.