DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6959 and tpbg

DIOPT Version :9

Sequence 1:NP_001138037.1 Gene:CG6959 / 41434 FlyBaseID:FBgn0037956 Length:425 Species:Drosophila melanogaster
Sequence 2:XP_002938502.1 Gene:tpbg / 100379816 XenbaseID:XB-GENE-1016283 Length:404 Species:Xenopus tropicalis


Alignment Length:421 Identity:112/421 - (26%)
Similarity:184/421 - (43%) Gaps:97/421 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ILVVAIAAIILAIGAGGVLGE--NSSSCGPNFPAACSCGQEMYESEMQYVVNCTNAGLVNTSVLE 64
            ||.:.:...||    |||..:  ..|.|    |.:|.|      ||....|.|....|  ..|.:
 Frog    33 ILFLFVLLHIL----GGVSSQLVQQSPC----PTSCVC------SEASRTVKCEKKDL--NVVPQ 81

  Fly    65 FMPEQVEVLIFTGNRITELPWNVFGSINNYKQLRIVDMSSNHIREIRGKSYHHVPRVERLILNHN 129
            .:|..|:.|..|||.|:.|. ..|.......:|..:|:|.||::|:....:.::|.:..|.|::|
 Frog    82 NIPPYVQNLTITGNNISTLN-RAFRQEQPLSELSNLDLSDNHLQELGSNVFSYLPSLTYLDLSNN 145

  Fly   130 NLS-ISRYEDEVNHHHPRVFSNFINLQSLHLTDAFEDNSSPQLSEDLHDIFVNSQLV-------- 185
            :|. ||....:|:.      |..|.|:.|.::::|::.            |:.|.|.        
 Frog   146 DLGIISNLSFQVDG------SGSIPLKELKISNSFKNE------------FLISMLAKSFDIGAP 192

  Fly   186 -KLQKLHLEQNEITHFKDRNVFCDLPSLRDLHLGDNDLRDLNFEV-RCLNNLRFLDLERNKFSFV 248
             ||:||.|..|:|. |..:.:|..||:||.::|.:|.|...:.:: :.|::|..|||..|....:
 Frog   193 RKLEKLELSGNDIL-FLPKGMFSPLPNLRHINLSNNSLTSFSADIFKDLSHLETLDLSNNALKRL 256

  Fly   249 K-PTDLRVLNELEERPNRTANLIVDFNLNPFGCDCRTAPFRAWITTTRVTVRNKDSLMCFHSTGH 312
            : .|...::::        .||:::.|.|.:.|||....|..|:..|:: |:...||:|      
 Frog   257 RNATSFDLISQ--------KNLLINLNDNSWECDCMIEEFSRWLKDTKL-VKESSSLVC------ 306

  Fly   313 VDAEPAHLLQMDMGQCADAIAAAATILNTAE---DEPHYGDPEASHLQPQAHISGHTATLIFLLI 374
              |.|.::..           .|...||.:|   .||   |...| ||         .:.:||.|
 Frog   307 --AFPENMKD-----------RAIVELNISELKCPEP---DDNTS-LQ---------TSYVFLGI 345

  Fly   375 VLTMILLGLLVALV-YVSRDKLKYMITPVFD 404
            ||.  |:|::..|| |::|..:|..|..:.|
 Frog   346 VLA--LIGVIFLLVLYLNRKGIKKWIYNIRD 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6959NP_001138037.1 leucine-rich repeat 70..96 CDD:275380 8/25 (32%)
LRR_8 95..161 CDD:290566 18/66 (27%)
leucine-rich repeat 97..120 CDD:275380 6/22 (27%)
LRR_RI <116..>224 CDD:238064 32/117 (27%)
leucine-rich repeat 121..153 CDD:275380 8/32 (25%)
leucine-rich repeat 154..186 CDD:275380 6/40 (15%)
LRR_8 186..245 CDD:290566 22/59 (37%)
leucine-rich repeat 187..211 CDD:275380 9/23 (39%)
leucine-rich repeat 212..234 CDD:275380 6/22 (27%)
leucine-rich repeat 235..258 CDD:275380 6/23 (26%)
TPKR_C2 276..328 CDD:301599 13/51 (25%)
tpbgXP_002938502.1 LRR <74..>277 CDD:227223 59/232 (25%)
leucine-rich repeat 90..112 CDD:275380 7/22 (32%)
leucine-rich repeat 113..136 CDD:275380 6/22 (27%)
leucine-rich repeat 137..160 CDD:275380 7/28 (25%)
leucine-rich repeat 165..194 CDD:275380 6/40 (15%)
LRR_8 194..253 CDD:338972 22/59 (37%)
leucine-rich repeat 195..218 CDD:275380 9/23 (39%)
leucine-rich repeat 219..242 CDD:275380 6/22 (27%)
leucine-rich repeat 267..281 CDD:275378 4/21 (19%)
LRRCT 277..328 CDD:214507 17/70 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I4981
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D341562at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24364
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.160

Return to query results.
Submit another query.