powered by:
Protein Alignment Kyat and AT1G17300
DIOPT Version :10
| Sequence 1: | NP_650121.1 |
Gene: | Kyat / 41433 |
FlyBaseID: | FBgn0037955 |
Length: | 450 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001320458.1 |
Gene: | AT1G17300 / 838302 |
AraportID: | AT1G17300 |
Length: | 146 |
Species: | Arabidopsis thaliana |
| Alignment Length: | 69 |
Identity: | 14/69 - (20%) |
| Similarity: | 20/69 - (28%) |
Gaps: | 31/69 - (44%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 301 LQMVHQNSVYTCPTPLQEGVARSFEVELARLGQPESYFLSLPRELKQKRDFMAKFLSESGMRPTI 365
|.|.|.:. .||...|......:| ||.::|.:.: |
plant 29 LTMTHSSQ-----------AARDLHVSKEMKKEP----------LKGEKDSLRR----------I 62
Fly 366 PEGG 369
|.||
plant 63 PRGG 66
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| Kyat | NP_650121.1 |
PRK08912 |
56..449 |
CDD:181580 |
14/69 (20%) |
| AT1G17300 | NP_001320458.1 |
PLN02231 |
119..>146 |
CDD:177876 |
|
|
Blue background indicates that the domain is not in
the aligned region.
|
Return to query results.
Submit another query.
