DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kyat and TAT

DIOPT Version :9

Sequence 1:NP_650121.1 Gene:Kyat / 41433 FlyBaseID:FBgn0037955 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_000344.1 Gene:TAT / 6898 HGNCID:11573 Length:454 Species:Homo sapiens


Alignment Length:440 Identity:95/440 - (21%)
Similarity:172/440 - (39%) Gaps:105/440 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 MQYKP--------LNLGQ-----GFPDDAAPEYVTHSLADIAKEQNPLLHQYTRGYGHVRLVNAL 110
            |:.||        |::|.     ..|.|  || ||.::.|..  .:...:.|....|.:.....:
Human    63 MKVKPNPNKTMISLSIGDPTVFGNLPTD--PE-VTQAMKDAL--DSGKYNGYAPSIGFLSSREEI 122

  Fly   111 SKLY----SGLVGKELNPLSDILITSGAYEALYSTIMGHVDVGDEVIIIEPFFDCYEPMVKMAGG 171
            :..|    :.|..|      |:::|||..:|:...:....:.|..:::..|.|..|:.:.:..| 
Human   123 ASYYHCPEAPLEAK------DVILTSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLAESMG- 180

  Fly   172 VPRFVPLKLRKTEGPISSADWVLDDAEFESLFNSKTKMIILNTPHNPIGKVFNRKELERIAELCR 236
                :.:||...   :....|.:|..:.|.|.:.||..:|:|.|.||.|.||:::.|::|..:..
Human   181 ----IEVKLYNL---LPEKSWEIDLKQLEYLIDEKTACLIVNNPSNPCGSVFSKRHLQKILAVAA 238

  Fly   237 KWNVLCVSDEVYEWLVFDGAEHIRICTL----PGMWDRTITLGSAGKTFSVTGWKIGWAYGPAEL 297
            :..|..::||:|..:||...::..:.||    |     .::.|...|.:.|.||::||.     |
Human   239 RQCVPILADEIYGDMVFSDCKYEPLATLSTDVP-----ILSCGGLAKRWLVPGWRLGWI-----L 293

  Fly   298 IRNLQMVHQNSV----------YTCPTPLQEGVARSFEVELARLGQPESYFLSLPRELKQKRDFM 352
            |.:.:.:..|.:          ...|..:.:|..:|.   |.|  .|..::.:....||...|..
Human   294 IHDRRDIFGNEIRDGLVKLSQRILGPCTIVQGALKSI---LCR--TPGEFYHNTLSFLKSNADLC 353

  Fly   353 AKFLSE-SGMRPTIPEGGYFMLADWSPLAGKIDLSSEPDKHRDYKFTKWMTKNMGLQGIPPSAFY 416
            ...|:. .|:||..|.|..:::..       |::...|:...|.:||:.:.....:..:|.:.| 
Human   354 YGALAAIPGLRPVRPSGAMYLMVG-------IEMEHFPEFENDVEFTERLVAEQSVHCLPATCF- 410

  Fly   417 SEPNKHLGEDFVR-------------------------YCFIKKQENLDK 441
            ..||      |:|                         :|....||..||
Human   411 EYPN------FIRVVITVPEVMMLEACSRIQEFCEQHYHCAEGSQEECDK 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KyatNP_650121.1 PRK08912 56..449 CDD:181580 95/440 (22%)
AAT_like 64..448 CDD:99734 92/427 (22%)
TATNP_000344.1 TAT_ubiq 1..40 CDD:285008
tyr_amTase_E 41..442 CDD:273529 90/426 (21%)
AAT_like 74..436 CDD:99734 87/409 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0436
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.