DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kyat and CG1640

DIOPT Version :9

Sequence 1:NP_650121.1 Gene:Kyat / 41433 FlyBaseID:FBgn0037955 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_727696.2 Gene:CG1640 / 32292 FlyBaseID:FBgn0030478 Length:575 Species:Drosophila melanogaster


Alignment Length:477 Identity:93/477 - (19%)
Similarity:152/477 - (31%) Gaps:200/477 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GSTPSVW-NEYIALAMQYKPLNLGQGFPDDAAPEYVTHSLADIAKEQNPLLH--------QYTRG 100
            |..|..: .:.:||..:.:.|:         :|:|.    .|:.|....:|:        .||..
  Fly   155 GQQPLTFLRQLLALTFETRLLD---------SPDYP----EDVKKRACAILNGCQGQSVGSYTDS 206

  Fly   101 YG----HVRLVNALSKLYSGLVGKELNPLSDILITSGAYEALYSTI-MGHVDVGDEVIIIEPFFD 160
            .|    ..::...:.|...|:...    ..||.:|.||...:.|.: |.:.:||           
  Fly   207 AGLEVVRRQVAQYIEKRDGGIASN----WQDIYLTGGASPGIKSILSMINAEVG----------- 256

  Fly   161 CYEPMVKMAGGVPRFVPLKLRKTEGPISSAD--------WVLDDAEFESLFNSKTK------MII 211
            |..|.|.:.  :|::.......:|..::..|        |.||..|.:..::...|      :::
  Fly   257 CKAPGVMVP--IPQYPLYSATISEYGMTKVDYYLEEETGWSLDRKELQRSYDEAKKVCNPRALVV 319

  Fly   212 LNTPHNPIGKVFNRKELERIAELCRKWNVLCVSDEVYEWLVFDGAEHIRICTLPGMWDRTITLGS 276
            :| |.||.|:|..|:.:|.|.:......||.::||||:..|:|....        .|        
  Fly   320 IN-PGNPTGQVLTRENIEEIIKFAHDNKVLVLADEVYQDNVYDKNSK--------FW-------- 367

  Fly   277 AGKTFSVTGWKIGWAYGPAELIRNLQMVHQNSVYTCPTPLQEGVARSFEVELARLGQPESYFLSL 341
               :|....:::|..|      |||:||.                                |||.
  Fly   368 ---SFKKVAYEMGDPY------RNLEMVS--------------------------------FLST 391

  Fly   342 PRELKQKRDFMAKFLSESGMRPTIPEGGYFMLADWSP-----------------LAGKIDLSS-- 387
            .:          .:|.|.|:|     |||..:.:..|                 .||::.:|:  
  Fly   392 SK----------GYLGECGIR-----GGYMEVLNLDPKVKAMLTKSITAALCSTTAGQVAVSALV 441

  Fly   388 ------EPD-----KHRD----------------------YKFTKWMTKNMGLQG---------I 410
                  ||.     |.||                      ||...       :||         |
  Fly   442 NPPQPGEPSYDLYKKERDGILAALKERAELVHKALNSFEGYKVNP-------VQGAMYVFPQIEI 499

  Fly   411 PPSAFYSEPNKHLGEDFVRYCF 432
            ||.|..:...|.:..| |.|.|
  Fly   500 PPKAIEAAKAKGMAPD-VFYAF 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KyatNP_650121.1 PRK08912 56..449 CDD:181580 91/465 (20%)
AAT_like 64..448 CDD:99734 89/457 (19%)
CG1640NP_727696.2 PTZ00377 99..575 CDD:240391 93/477 (19%)
AAT_like 178..564 CDD:99734 88/445 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467878
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0436
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.