DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kyat and Accs

DIOPT Version :9

Sequence 1:NP_650121.1 Gene:Kyat / 41433 FlyBaseID:FBgn0037955 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001254463.1 Gene:Accs / 311218 RGDID:1309314 Length:475 Species:Rattus norvegicus


Alignment Length:364 Identity:74/364 - (20%)
Similarity:145/364 - (39%) Gaps:79/364 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 FPDDAAPEYVTHSLADIAKEQNP--------------------------LLH------QYTRGYG 102
            |.|.|...|.|:.:.:..:::||                          :||      ||....|
  Rat    51 FWDSAEEGYRTYHMDEYDEDKNPSGIINLGTSENKLCFDLLSWRLTQNDMLHVEPSLLQYPDWRG 115

  Fly   103 HVRLVNALSKLYSGLVGKELNPL--SDILITSGA---YEALYSTIMGHVDVGDEVIIIEPFFDCY 162
            |..|...:::..| ...|...||  .::::.:|.   :.|| :|::  .:.|:.::|..|::...
  Rat   116 HRFLRKEVARFLS-FYCKSPAPLKPENVVVLNGCASLFSAL-ATVL--CEPGEVLLIPTPYYGAI 176

  Fly   163 EPMVKMAGGV--------PRFVPLKLRKTEGPISSADWVLDDAEFESLFNSKTKMIILNTPHNPI 219
            ...:.:.|.:        .:...|..|..:..:...:..|.....|.:   |.|.:||..|.||:
  Rat   177 TQHIYLYGNIRLAYVYLDSKVTGLNTRPFQLTVEKLEMALQGVNSEGV---KVKGLILINPQNPL 238

  Fly   220 GKVFNRKELERIAELCRKWNVLCVSDEVYEWLVFDGAEHIR-ICTLPGMWD--RTITLGSAGKTF 281
            |.:::.:||:.......:..:..:.||||...||:.:...| :.:|..:.|  ||..:.:..|.|
  Rat   239 GDIYSPEELQDFLGFAMRHKLHVIMDEVYMLSVFEESLGYRSVLSLERLPDPQRTHVMWATSKDF 303

  Fly   282 SVTGWKIGWAYGP----AELIRNLQMVHQNSVYTCPTPLQEGVARSFEVELARLGQPESYF--LS 340
            .::|.:.|..|..    |..:.:|...|             |::...:.::|:|.|...:.  :.
  Rat   304 GMSGLRFGVLYTENQHVATAVASLCRYH-------------GLSGLVQHQMAQLLQDHDWISQVY 355

  Fly   341 LPR---ELKQKRDFMAKFLSESGMRPTIPEG-GYFMLAD 375
            ||.   .||....::::.|...|: |.:..| |:|:..|
  Rat   356 LPENHARLKAAHTYVSEELRALGI-PFVSRGAGFFIWVD 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KyatNP_650121.1 PRK08912 56..449 CDD:181580 74/364 (20%)
AAT_like 64..448 CDD:99734 74/364 (20%)
AccsNP_001254463.1 PLN02450 35..475 CDD:178069 74/364 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0436
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.