DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kyat and Tat

DIOPT Version :9

Sequence 1:NP_650121.1 Gene:Kyat / 41433 FlyBaseID:FBgn0037955 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_036800.1 Gene:Tat / 24813 RGDID:3820 Length:454 Species:Rattus norvegicus


Alignment Length:314 Identity:72/314 - (22%)
Similarity:136/314 - (43%) Gaps:48/314 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 PL--SDILITSGAYEALYSTIMGHVDVGDEVIIIEPFFDCYEPMVKMAGGVPRFVPLKLRKTEGP 186
            ||  .|:::|||..:|:...:....:.|..::|..|.|..|..:.:..|     :.:||...   
  Rat   132 PLEAKDVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMG-----IEVKLYNL--- 188

  Fly   187 ISSADWVLDDAEFESLFNSKTKMIILNTPHNPIGKVFNRKELERIAELCRKWNVLCVSDEVYEWL 251
            :....|.:|..:.|||.:.||..:::|.|.||.|.||:::.|::|..:..:..|..::||:|..:
  Rat   189 LPEKSWEIDLKQLESLIDEKTACLVVNNPSNPCGSVFSKRHLQKILAVAERQCVPILADEIYGDM 253

  Fly   252 VFDGAEHIRICTL----PGMWDRTITLGSAGKTFSVTGWKIGWAYGPAELIRNLQMVHQNSV--- 309
            ||...::..:..|    |     .::.|...|.:.|.||::||.     ||.:.:.:..|.:   
  Rat   254 VFSDCKYEPLANLSTNVP-----ILSCGGLAKRWLVPGWRLGWI-----LIHDRRDIFGNEIRDG 308

  Fly   310 -------YTCPTPLQEGVARSFEVELARLGQPESYFLSLPRELKQKRDFMAKFLSE-SGMRPTIP 366
                   ...|..:.:|..:|.   |.|  .|:.::......||...|.....|:. .|::|..|
  Rat   309 LVKLSQRILGPCTIVQGALKSI---LQR--TPQEFYHDTLSFLKSNADLCYGALAAIPGLQPVRP 368

  Fly   367 EGGYFMLADWSPLAGKIDLSSEPDKHRDYKFTKWMTKNMGLQGIPPSAFYSEPN 420
            .|..:::..       |::...|:...|.:||:.:.....:..:|.:.| ..||
  Rat   369 SGAMYLMVG-------IEMEHFPEFENDVEFTERLIAEQAVHCLPATCF-EYPN 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KyatNP_650121.1 PRK08912 56..449 CDD:181580 72/314 (23%)
AAT_like 64..448 CDD:99734 72/314 (23%)
TatNP_036800.1 TAT_ubiq 1..40 CDD:285008
tyr_amTase_E 41..442 CDD:273529 72/314 (23%)
AAT_like 74..436 CDD:99734 72/314 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0436
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.