DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kyat and Gpt2

DIOPT Version :9

Sequence 1:NP_650121.1 Gene:Kyat / 41433 FlyBaseID:FBgn0037955 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_776291.1 Gene:Gpt2 / 108682 MGIID:1915391 Length:522 Species:Mus musculus


Alignment Length:405 Identity:88/405 - (21%)
Similarity:152/405 - (37%) Gaps:101/405 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KRSLREQ-FQLQALRHQQTAIK--------MEKFDLPKRLQGSTPSVWNEYI------ALAMQYK 62
            :||.|:: ..|:::..|..|::        ::..::...||......:.|.|      |.||..:
Mouse    40 ERSPRDRILTLESMNPQVKAVEYAVRGPIVLKAGEIEMELQRGIKKPFTEVIRANIGDAHAMGQQ 104

  Fly    63 PL-------------NL--GQGFPDDAAPEYVTHSLADIAKEQNPLLH--------QYTRGYGHV 104
            |:             ||  ...||:||            .|....:|.        .|:...|  
Mouse   105 PITFLRQVMALCTYPNLLNSPSFPEDA------------KKRARRILQACGGNSLGSYSASQG-- 155

  Fly   105 RLVNALSKLYSGLV----GKELNPLSDILITSGAYEALYSTIM-------GHVDVGDEVIIIEPF 158
              ||.:.:..:..:    |...:| .:|.:|:||.:.: |||:       |....|  |:|..|.
Mouse   156 --VNCIREDVAAFITRRDGVPADP-DNIYLTTGASDGI-STILKLLVSGGGKSRTG--VMIPIPQ 214

  Fly   159 FDCYEPMVKMAGGVPRFVPLKLRKTEGPISSADWVLDDAEF-ESLFNSK----TKMIILNTPHNP 218
            :..|..::.....|.....|.....        |.|:..|. .:|..:|    .|::.:..|.||
Mouse   215 YPLYSAVISELDAVQVNYYLDEENC--------WALNVDELRRALRQAKDHCDPKVLCIINPGNP 271

  Fly   219 IGKVFNRKELERIAELCRKWNVLCVSDEVYEWLVF--DGAEHIRICTLPGM---WDRTITLGSAG 278
            .|:|.:||.:|.:.....:..:..::||||:..|:  |...|.....|..|   :...:.|.|..
Mouse   272 TGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFHSFKKVLYQMGHEYSSNVELASFH 336

  Fly   279 KTFSVTGWKIGWAYGPAELIRNL------QMVHQNSVYTCPTPLQEGVARSFEVELARLGQPESY 337
            .|......:.|:..|..|:| ||      |:|...||..|| |:....|....|.....|: ||:
Mouse   337 STSKGYMGECGYRGGYMEVI-NLHPEIKGQLVKLLSVRLCP-PVSGQAAMDIVVNPPEPGE-ESF 398

  Fly   338 FLSLPRELKQKRDFM 352
                 .:..::::|:
Mouse   399 -----EQFSREKEFV 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KyatNP_650121.1 PRK08912 56..449 CDD:181580 78/347 (22%)
AAT_like 64..448 CDD:99734 74/339 (22%)
Gpt2NP_776291.1 PTZ00377 48..522 CDD:240391 85/397 (21%)
AAT_like 123..512 CDD:99734 72/322 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0436
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.